SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272626.lin1671 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272626.lin1671
Domain Number 1 Region: 4-249
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.53e-74
Family Tryptophan biosynthesis enzymes 0.000053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272626.lin1671
Sequence length 252
Comment (Listeria innocua)
Sequence
MTFLEEILAQKAVEVAEMPLEQVAEKRKTYSFYDFLKENTEQMQLIAEVKRASPSKGEIN
MDVNPVAQAKSYEAAGAGMISVLTDPIFFKGSIEDLREVAKNVAIPVLCKDFIISEKQLI
RARNAGATVVLLIISALTEDELALLFKQASALDLEVLVEVHDRDELALAQKIGAKLIGVN
NRNLHTFEVDIAVSEMVANDFSTEACFISESGFKTADDVNRVSKEFNAVLVGEALMRDKT
PQKAAESLKVKR
Download sequence
Identical sequences Q92B79
gi|16800739|ref|NP_471007.1| WP_010991636.1.46653 WP_010991636.1.67429 WP_010991636.1.70104 WP_010991636.1.83607 272626.lin1671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]