SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272630.MexAM1_META1p0002 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272630.MexAM1_META1p0002
Domain Number 1 Region: 252-373
Classification Level Classification E-value
Superfamily DNA clamp 2.32e-35
Family DNA polymerase III, beta subunit 0.00056
Further Details:      
 
Domain Number 2 Region: 1-119
Classification Level Classification E-value
Superfamily DNA clamp 5.65e-26
Family DNA polymerase III, beta subunit 0.0002
Further Details:      
 
Domain Number 3 Region: 127-251
Classification Level Classification E-value
Superfamily DNA clamp 1.99e-25
Family DNA polymerase III, beta subunit 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 272630.MexAM1_META1p0002
Sequence length 373
Comment (Methylobacterium extorquens AM1)
Sequence
MRVTVERAALLKSLGHVHRVVERRNTIPILSNVLLRTGENGLQLKATDLDIEVTETVAAD
VLDAGATTVPAHVIYDIVRKLPEGAQVSLETSGETGQMTIRSGRSRFALGALPEGDFPDL
AAGELPHSFAIPAAELKQLIEKTQFAISTEETRYYLNGIYFHTLEVEGALKLRAVATDGH
RLARVETEAPEGSRGMPGIIVPRKAVAEIQKLVDDGGESVQVELSPAKIRLTFAGGVILI
SKLIDGTFPDYQRVIPTGNDKRLTVERDAFAKAVDRVSTISSERGRAVKLAVSEGRLALS
VTNPDAGSATEELDVDYEASALDIGFNARYLLDITAQLQGDTALFKLADPGSPTLIQDRD
GAPALYVLMPMRV
Download sequence
Identical sequences B7L001 C5AP43 C7C6F8 H1KFJ8
gi|254558655|ref|YP_003065750.1| 272630.MexAM1_META1p0002 440085.Mchl_0003 661410.METDI0002 WP_003598299.1.1114 WP_003598299.1.3851 WP_003598299.1.60027 WP_003598299.1.65134 gi|240136785|ref|YP_002961252.1| gi|218528085|ref|YP_002418901.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]