SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272630.MexAM1_META1p3431 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272630.MexAM1_META1p3431
Domain Number 1 Region: 221-371
Classification Level Classification E-value
Superfamily beta-Roll 3.4e-20
Family Serralysin-like metalloprotease, C-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 21-215
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.58e-19
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.012
Further Details:      
 
Domain Number 3 Region: 433-573
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000317
Family Leech intramolecular trans-sialidase, N-terminal domain 0.079
Further Details:      
 
Weak hits

Sequence:  272630.MexAM1_META1p3431
Domain Number - Region: 580-711
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000475
Family Leech intramolecular trans-sialidase, N-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272630.MexAM1_META1p3431
Sequence length 713
Comment (Methylobacterium extorquens AM1)
Sequence
MVKISTVEKSDSSLVNAVITRYKWGENTLNYGFKVQDIDKNGVSDFDEGQWRSFYKSIFD
NVSSFTNLDFRETSFEESTLGQILEVGGGGQSSNPYPELPNGNTYTVVRFFGSVASASES
IYRGQWSSVWYHEIGHSLGLAHPFEQPGVIAGVRSDADLGTNFINSSLYTVMSYSSFVWG
EDNPWTRTQDAGRTFMNASAGSYMPIDIAALQHLYGARAANTGDTVYTFGDDLRTNAGFN
TIWDTGGNDTIRYVGSSRAKIDLRAATLKDEIGGGGFVSTSDKLNGGFLIANGVAIETAI
GGSKDDILHGHDGDNTLIGGAGNDTLFGYAGNDVLEGGTGSDRLDGGEGIDAARFAGQSR
DYAIVYDASTTAGAFAVKHIATGALDTLASIETLVFDDTALESQGVFTHLEARFGALPSG
SQKFELALSPEADDPIATDVADIDGAFTASATVLFADLAGGSWQRVFDFGNGPASDNIFL
GQVGRSSDMEFTVFNGGKAASIVARGAIVEGQEAEWTADVDAGGWMRLFKDGALLAQGQG
VVPRDIERANEFVGKSNWSWDTPLIGTVSDLTVTAHNVIPEIDGAFTMFAEARFDNLAGG
HYQRLFDTGNGRDSDNIWVGQVGNGDDMAFEILTGSVKHQITAHDVIVQGETADWQASVT
DGGYMRLFKNDHLVAEGQGAAPLDVTRADDLIGQSNWTWDTPLIGKVSDLFFV
Download sequence
Identical sequences C5AY69 H1KKE5
272630.MexAM1_META1p3431 gi|240139968|ref|YP_002964445.1| WP_003600964.1.1114 WP_003600964.1.3851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]