SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272631.ML0627 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272631.ML0627
Domain Number 1 Region: 111-298
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.45e-40
Family Tandem AAA-ATPase domain 0.051
Further Details:      
 
Domain Number 2 Region: 17-79
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000134
Family Eukaryotic type KH-domain (KH-domain type I) 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272631.ML0627
Sequence length 349
Comment (Mycobacterium leprae)
Sequence
MTHHETSAVDASSASMHVRSTIDVPPDLVVGLLGSADENLRALERMLSADLHVRGNTVAF
SGEPADVALAERAISELVAIVASGHPLTPEVVRHGVAMLVGTGNESPAEVLTLDILLRRG
KTVRPKTLNQKRYVDAIDANTIVFGIGPAGTGKTYLAMAKAVNALQTKQVTRIILTRPAV
EAGERLGFLPGTLSEKIDPYLRPLYDALYDMMDPELIPKLMSSGVIEVASLAYMRGRTLN
DAFIVLDEAQNTTAEQMKMFLTRLGFGSKVVVTGDVTQIDLPGGARSGLRAAVDILEHID
DIYVAELASVDVVRHRLVSEIVDAYAEYEEHDLGMNRAARRASGARNRR
Download sequence
Identical sequences A0A0H3MPR2 A0A197SFQ0 Q49751
NP_301520.1.10168 WP_010907844.1.20769 WP_010907844.1.50976 WP_010907844.1.86095 gi|15827257|ref|NP_301520.1| 272631.ML0627 561304.MLBr_00627 gi|221229735|ref|YP_002503151.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]