SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272631.ML1654 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272631.ML1654
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily ACP-like 6.41e-26
Family Acyl-carrier protein (ACP) 0.00000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272631.ML1654
Sequence length 115
Comment (Mycobacterium leprae)
Sequence
MAVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIP
DEDLAGLRTVGDVVTYIQKLEEENPEAAEALRAKIVSENPEAAANVQARLETESK
Download sequence
Identical sequences A0A0H3MZY8 A0A197SDM6 O69475
NP_302135.1.10168 WP_010908456.1.20769 WP_010908456.1.50976 WP_010908456.1.86095 gi|15827872|ref|NP_302135.1| 272631.ML1654 561304.MLBr_01654 gi|221230349|ref|YP_002503765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]