SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272632.MSC_0611 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272632.MSC_0611
Domain Number 1 Region: 160-210
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 0.000000000000248
Family Head domain of nucleotide exchange factor GrpE 0.0027
Further Details:      
 
Domain Number 2 Region: 64-152
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 0.0000000000248
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272632.MSC_0611
Sequence length 210
Comment (Mycoplasma mycoides)
Sequence
MKLLIQRRIKMTEELKNKKINKKYYSQNRNKTKAEFQKADIKKNQYLNLKTKLNNVLLEV
QNLKELNETLKKELKSEKQLNLAEISNLTKKYNQKELETKKYGASNLAKDLIQPLEILKK
VVNAPNNNEVVQAYVKGFEMIINQINNVLESHHIKAMNVKVGDMFDPHLHDANEAVETDE
YKTNQIVGVLSDGYMIHDKVLVYAIVKVAK
Download sequence
Identical sequences gi|42561140|ref|NP_975591.1| NP_975591.1.55851 WP_011166787.1.11018 WP_011166787.1.17500 WP_011166787.1.32010 WP_011166787.1.3214 WP_011166787.1.37196 WP_011166787.1.51345 WP_011166787.1.72634 WP_011166787.1.84266 272632.MSC_0611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]