SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272633.MYPE10230 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272633.MYPE10230
Domain Number 1 Region: 7-168
Classification Level Classification E-value
Superfamily PRTase-like 6.19e-45
Family Phosphoribosyltransferases (PRTases) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 272633.MYPE10230
Sequence length 172
Comment (Mycoplasma penetrans)
Sequence
MGYEEIKNTIATIEDFPKKGISFKDITPLLLDHKKMNFIIDELAKFAKTIDFDIIVAPES
RGFLFGLPLALNLKKPFVPIRKKGKLPREVISQEYELEYGKATIEVTKNDIPANSKVLII
DDLIATGGTTVAIQDLVTKLGSTVVGQAYLIELVGLCDYEKLQGKFFSMIKY
Download sequence
Identical sequences Q8EUA8
WP_011077836.1.43808 272633.MYPE10230 gi|26554470|ref|NP_758404.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]