SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272635.MYPU_1400 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272635.MYPU_1400
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily L28p-like 1.22e-18
Family Ribosomal protein L31p 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272635.MYPU_1400
Sequence length 69
Comment (Mycoplasma pulmonis)
Sequence
MQKDIHLKMEPLKITCSTCFTSFDIVSSRKTIAIDICSKCHPFYTGDRTLAKATGQIDKF
QKRLQKKQK
Download sequence
Identical sequences Q98R70
gi|15828611|ref|NP_325971.1| 272635.MYPU_1400 WP_010924944.1.72207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]