SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 272844.PAB2079 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  272844.PAB2079
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily PIN domain-like 1.91e-26
Family PIN domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 272844.PAB2079
Sequence length 123
Comment (Pyrococcus abyssi)
Sequence
MDKLLDTSVLIEVFRGNAKILTQLPPEEEYAIPSIVLFELLCGGLKPKQRLALEKMPVVN
FDKTSAEVAGEIFKDLISKGLRPPTKDLLIAATAIAHNIPLYTCDRGFERFKEYGLKLVI
LER
Download sequence
Identical sequences Q9V1M4
WP_010867525.1.84333 272844.PAB2079 gi|14520619|ref|NP_126094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]