SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273036.SAB1148 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273036.SAB1148
Domain Number 1 Region: 324-469
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.2e-31
Family HD domain 0.009
Further Details:      
 
Domain Number 2 Region: 207-303
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.14e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 273036.SAB1148
Sequence length 519
Comment (Staphylococcus aureus RF122)
Sequence
MNLLSLLLILLGIILGVVGGYVVARNLLLQKQSQARQTAEDIVNQAHKEADNIKKEKLLE
AKEENQILREQTEAELRERRSELQRQETRLLQKEENLERKSDLLDKKDEILEQKESKIEE
KQQQVDAKESSVQTLIMKHEQELERISGLTQEEAINEQLQRVEEELSQDIAVLVKEKEKE
AKEKVDKTAKELLATAVQRLAADHTSESTVSVVNLPNDEMKGRIIGREGRNIRTLETLTG
IDLIIDDTPEAVILSGFDPIRREIARTALVNLVSDGRIHPGRIEDMVEKARKEVDDIIRE
AGEQATFEVNAHNMHPDLVKIVGRLNYRTSYGQNVLKHSIEVAHLASMLAAELGEDETLA
KRAGLLHDVGKAIDHEVEGSHVEIGVELAKKYGENETVINAIHSHHGDVEPTSIISILVA
AADALSAARPGARKETLENYIRRLERLETLSESYDGVEKAFAIQAGREIRVIVSPEEIDD
LKSYRLARDIKNQIEDELQYPGHIKVTVVRETRAVEYAK
Download sequence
Identical sequences A0A0D1JX11 A0A0E0VNN5 A0A0E1VK06 A0A0E1XGI7 A0A1E8WXD8 A0A2H5AND7 A6QGI5 A6U1A5 A7X1S5 A8Z1V7 P67277 P67278 P67279 Q2FHF2 Q2FZ08 Q2YXN1 Q5HGE5 Q6G9S7 Q6GHE9 T1YA56 W8TWS4
gi|87161243|ref|YP_493876.1| gi|384547529|ref|YP_005736782.1| gi|470195147|ref|YP_007581499.1| gi|57651856|ref|YP_186162.1| gi|404478627|ref|YP_006710057.1| gi|21282898|ref|NP_645986.1| gi|384864513|ref|YP_005749872.1| gi|537460962|ref|YP_008491402.1| gi|269202903|ref|YP_003282172.1| gi|470191217|ref|YP_007577527.1| ZR292 158878.SAV1286 158879.SA1129 196620.MW1169 273036.SAB1148 282458.SAR1262 282459.SAS1220 359787.SaurJH1_1372 418127.SAHV_1276 426430.NWMN_1195 451515.SAUSA300_1179 451516.USA300HOU_1218 681288.SAAV_1261 93061.SAOUHSC_01263 93062.SACOL1305 gi|386728972|ref|YP_006195355.1| gi|386830821|ref|YP_006237475.1| gi|82750886|ref|YP_416627.1| gi|384867828|ref|YP_005748024.1| gi|470193183|ref|YP_007579536.1| gi|49483449|ref|YP_040673.1| gi|470222671|ref|YP_007621228.1| gi|385781514|ref|YP_005757685.1| gi|379014477|ref|YP_005290713.1| gi|470199080|ref|YP_007585480.1| gi|49486125|ref|YP_043346.1| gi|470197113|ref|YP_007583514.1| gi|150393835|ref|YP_001316510.1| gi|384550043|ref|YP_005739295.1| gi|537442615|ref|YP_008485192.1| WP_001050913.1.100013 WP_001050913.1.100041 WP_001050913.1.100049 WP_001050913.1.100057 WP_001050913.1.10006 WP_001050913.1.100067 WP_001050913.1.100072 WP_001050913.1.100075 WP_001050913.1.100084 WP_001050913.1.100088 WP_001050913.1.100094 WP_001050913.1.100096 WP_001050913.1.100117 WP_001050913.1.100122 WP_001050913.1.100154 WP_001050913.1.100171 WP_001050913.1.100180 WP_001050913.1.100184 WP_001050913.1.100189 WP_001050913.1.100235 WP_001050913.1.100265 WP_001050913.1.100272 WP_001050913.1.100298 WP_001050913.1.100307 WP_001050913.1.100310 WP_001050913.1.10032 WP_001050913.1.100335 WP_001050913.1.100347 WP_001050913.1.100357 WP_001050913.1.100366 WP_001050913.1.100384 WP_001050913.1.100391 WP_001050913.1.100399 WP_001050913.1.10041 WP_001050913.1.100452 WP_001050913.1.10046 WP_001050913.1.10050 WP_001050913.1.100507 WP_001050913.1.100527 WP_001050913.1.10053 WP_001050913.1.100534 WP_001050913.1.100535 WP_001050913.1.100551 WP_001050913.1.100560 WP_001050913.1.100562 WP_001050913.1.100582 WP_001050913.1.100596 WP_001050913.1.100604 WP_001050913.1.100612 WP_001050913.1.100613 WP_001050913.1.100618 WP_001050913.1.100631 WP_001050913.1.100647 WP_001050913.1.100665 WP_001050913.1.100678 WP_001050913.1.100693 WP_001050913.1.100699 WP_001050913.1.100704 WP_001050913.1.100719 WP_001050913.1.100726 WP_001050913.1.100761 WP_001050913.1.100768 WP_001050913.1.100785 WP_001050913.1.100823 WP_001050913.1.100832 WP_001050913.1.100834 WP_001050913.1.10085 WP_001050913.1.100860 WP_001050913.1.100888 WP_001050913.1.1009 WP_001050913.1.100903 WP_001050913.1.100920 WP_001050913.1.100922 WP_001050913.1.100934 WP_001050913.1.100956 WP_001050913.1.100963 WP_001050913.1.10097 WP_001050913.1.100981 WP_001050913.1.100986 WP_001050913.1.100987 WP_001050913.1.101002 WP_001050913.1.101017 WP_001050913.1.101019 WP_001050913.1.101023 WP_001050913.1.101027 WP_001050913.1.101055 WP_001050913.1.101068 WP_001050913.1.101071 WP_001050913.1.101072 WP_001050913.1.101084 WP_001050913.1.101103 WP_001050913.1.10111 WP_001050913.1.101142 WP_001050913.1.101160 WP_001050913.1.101177 WP_001050913.1.101192 WP_001050913.1.101217 WP_001050913.1.101240 WP_001050913.1.101262 WP_001050913.1.101266 WP_001050913.1.101298 WP_001050913.1.101327 WP_001050913.1.101329 WP_001050913.1.101330 WP_001050913.1.101352 WP_001050913.1.101355 WP_001050913.1.101375 WP_001050913.1.101379 WP_001050913.1.101393 WP_001050913.1.101397 WP_001050913.1.101402 WP_001050913.1.101406 WP_001050913.1.101414 WP_001050913.1.101440 WP_001050913.1.101441 WP_001050913.1.101458 WP_001050913.1.10148 WP_001050913.1.101490 WP_001050913.1.101495 WP_001050913.1.1015 WP_001050913.1.101505 WP_001050913.1.101511 WP_001050913.1.101531 WP_001050913.1.101566 WP_001050913.1.101567 WP_001050913.1.101570 WP_001050913.1.101598 WP_001050913.1.101615 WP_001050913.1.101617 WP_001050913.1.101619 WP_001050913.1.101627 WP_001050913.1.101645 WP_001050913.1.10165 WP_001050913.1.101657 WP_001050913.1.10166 WP_001050913.1.101661 WP_001050913.1.101670 WP_001050913.1.101691 WP_001050913.1.101704 WP_001050913.1.101716 WP_001050913.1.101725 WP_001050913.1.101728 WP_001050913.1.101731 WP_001050913.1.101745 WP_001050913.1.101758 WP_001050913.1.101775 WP_001050913.1.101778 WP_001050913.1.101779 WP_001050913.1.101788 WP_001050913.1.101813 WP_001050913.1.101820 WP_001050913.1.101821 WP_001050913.1.101824 WP_001050913.1.101825 WP_001050913.1.101831 WP_001050913.1.101852 WP_001050913.1.101902 WP_001050913.1.101921 WP_001050913.1.101922 WP_001050913.1.101943 WP_001050913.1.101950 WP_001050913.1.101999 WP_001050913.1.102064 WP_001050913.1.102065 WP_001050913.1.102066 WP_001050913.1.102070 WP_001050913.1.102084 WP_001050913.1.10209 WP_001050913.1.102096 WP_001050913.1.102123 WP_001050913.1.102126 WP_001050913.1.102130 WP_001050913.1.102132 WP_001050913.1.10214 WP_001050913.1.1022 WP_001050913.1.10232 WP_001050913.1.10238 WP_001050913.1.10240 WP_001050913.1.10244 WP_001050913.1.10249 WP_001050913.1.1025 WP_001050913.1.10274 WP_001050913.1.10294 WP_001050913.1.10301 WP_001050913.1.10306 WP_001050913.1.10308 WP_001050913.1.1031 WP_001050913.1.1032 WP_001050913.1.10321 WP_001050913.1.10343 WP_001050913.1.10355 WP_001050913.1.10358 WP_001050913.1.10397 WP_001050913.1.10408 WP_001050913.1.1043 WP_001050913.1.10431 WP_001050913.1.10436 WP_001050913.1.10450 WP_001050913.1.10469 WP_001050913.1.10478 WP_001050913.1.10481 WP_001050913.1.10503 WP_001050913.1.1052 WP_001050913.1.10526 WP_001050913.1.10542 WP_001050913.1.10543 WP_001050913.1.10565 WP_001050913.1.10583 WP_001050913.1.1060 WP_001050913.1.10614 WP_001050913.1.10617 WP_001050913.1.10624 WP_001050913.1.10644 WP_001050913.1.10664 WP_001050913.1.10679 WP_001050913.1.10707 WP_001050913.1.10726 WP_001050913.1.10742 WP_001050913.1.10749 WP_001050913.1.10751 WP_001050913.1.1077 WP_001050913.1.10783 WP_001050913.1.10785 WP_001050913.1.10823 WP_001050913.1.10841 WP_001050913.1.10843 WP_001050913.1.10858 WP_001050913.1.1087 WP_001050913.1.10917 WP_001050913.1.10919 WP_001050913.1.10928 WP_001050913.1.10942 WP_001050913.1.10950 WP_001050913.1.10965 WP_001050913.1.10969 WP_001050913.1.1097 WP_001050913.1.10976 WP_001050913.1.10979 WP_001050913.1.10985 WP_001050913.1.10986 WP_001050913.1.11001 WP_001050913.1.11067 WP_001050913.1.11069 WP_001050913.1.11073 WP_001050913.1.11074 WP_001050913.1.11076 WP_001050913.1.11083 WP_001050913.1.11084 WP_001050913.1.11129 WP_001050913.1.1115 WP_001050913.1.11162 WP_001050913.1.11184 WP_001050913.1.11188 WP_001050913.1.1120 WP_001050913.1.11202 WP_001050913.1.11220 WP_001050913.1.11223 WP_001050913.1.11228 WP_001050913.1.11234 WP_001050913.1.1124 WP_001050913.1.11261 WP_001050913.1.11281 WP_001050913.1.11282 WP_001050913.1.11286 WP_001050913.1.11294 WP_001050913.1.11312 WP_001050913.1.11322 WP_001050913.1.11333 WP_001050913.1.11348 WP_001050913.1.11353 WP_001050913.1.11365 WP_001050913.1.11377 WP_001050913.1.11378 WP_001050913.1.11391 WP_001050913.1.11403 WP_001050913.1.11407 WP_001050913.1.11434 WP_001050913.1.11441 WP_001050913.1.11447 WP_001050913.1.11451 WP_001050913.1.11463 WP_001050913.1.1147 WP_001050913.1.11475 WP_001050913.1.11488 WP_001050913.1.11492 WP_001050913.1.11494 WP_001050913.1.11504 WP_001050913.1.1151 WP_001050913.1.11513 WP_001050913.1.1152 WP_001050913.1.11525 WP_001050913.1.11540 WP_001050913.1.11556 WP_001050913.1.11558 WP_001050913.1.11571 WP_001050913.1.11580 WP_001050913.1.11592 WP_001050913.1.11611 WP_001050913.1.11625 WP_001050913.1.11640 WP_001050913.1.11646 WP_001050913.1.11655 WP_001050913.1.11660 WP_001050913.1.11663 WP_001050913.1.11692 WP_001050913.1.117 WP_001050913.1.1171 WP_001050913.1.11719 WP_001050913.1.11720 WP_001050913.1.11723 WP_001050913.1.11730 WP_001050913.1.11736 WP_001050913.1.11741 WP_001050913.1.11768 WP_001050913.1.11781 WP_001050913.1.11794 WP_001050913.1.11795 WP_001050913.1.11816 WP_001050913.1.11828 WP_001050913.1.11829 WP_001050913.1.11837 WP_001050913.1.11884 WP_001050913.1.11894 WP_001050913.1.11903 WP_001050913.1.11904 WP_001050913.1.11919 WP_001050913.1.11969 WP_001050913.1.11991 WP_001050913.1.12005 WP_001050913.1.12019 WP_001050913.1.12026 WP_001050913.1.12029 WP_001050913.1.12042 WP_001050913.1.1205 WP_001050913.1.12073 WP_001050913.1.12098 WP_001050913.1.12123 WP_001050913.1.1213 WP_001050913.1.12137 WP_001050913.1.12149 WP_001050913.1.12158 WP_001050913.1.12170 WP_001050913.1.12175 WP_001050913.1.12181 WP_001050913.1.12193 WP_001050913.1.12194 WP_001050913.1.12201 WP_001050913.1.12233 WP_001050913.1.12256 WP_001050913.1.12272 WP_001050913.1.12297 WP_001050913.1.12328 WP_001050913.1.12330 WP_001050913.1.12361 WP_001050913.1.12366 WP_001050913.1.12391 WP_001050913.1.12436 WP_001050913.1.12437 WP_001050913.1.12447 WP_001050913.1.12498 WP_001050913.1.12508 WP_001050913.1.12516 WP_001050913.1.1252 WP_001050913.1.12555 WP_001050913.1.1257 WP_001050913.1.12597 WP_001050913.1.12598 WP_001050913.1.12605 WP_001050913.1.12608 WP_001050913.1.12618 WP_001050913.1.12639 WP_001050913.1.12668 WP_001050913.1.12685 WP_001050913.1.12705 WP_001050913.1.12707 WP_001050913.1.12711 WP_001050913.1.12715 WP_001050913.1.12733 WP_001050913.1.12737 WP_001050913.1.1276 WP_001050913.1.12770 WP_001050913.1.12771 WP_001050913.1.12772 WP_001050913.1.12780 WP_001050913.1.12788 WP_001050913.1.12802 WP_001050913.1.12822 WP_001050913.1.12829 WP_001050913.1.12833 WP_001050913.1.12845 WP_001050913.1.12858 WP_001050913.1.12862 WP_001050913.1.12884 WP_001050913.1.12886 WP_001050913.1.12903 WP_001050913.1.12904 WP_001050913.1.12918 WP_001050913.1.12920 WP_001050913.1.12937 WP_001050913.1.12938 WP_001050913.1.12951 WP_001050913.1.12977 WP_001050913.1.13013 WP_001050913.1.13039 WP_001050913.1.13062 WP_001050913.1.13072 WP_001050913.1.13091 WP_001050913.1.13104 WP_001050913.1.13112 WP_001050913.1.13154 WP_001050913.1.13164 WP_001050913.1.13169 WP_001050913.1.13170 WP_001050913.1.13189 WP_001050913.1.13228 WP_001050913.1.13243 WP_001050913.1.13250 WP_001050913.1.13303 WP_001050913.1.13307 WP_001050913.1.13317 WP_001050913.1.13322 WP_001050913.1.13326 WP_001050913.1.13336 WP_001050913.1.13355 WP_001050913.1.13366 WP_001050913.1.13376 WP_001050913.1.13379 WP_001050913.1.13381 WP_001050913.1.13405 WP_001050913.1.13448 WP_001050913.1.13468 WP_001050913.1.1347 WP_001050913.1.13486 WP_001050913.1.13501 WP_001050913.1.13505 WP_001050913.1.13514 WP_001050913.1.13531 WP_001050913.1.13532 WP_001050913.1.13554 WP_001050913.1.13556 WP_001050913.1.13557 WP_001050913.1.13568 WP_001050913.1.13598 WP_001050913.1.13612 WP_001050913.1.13617 WP_001050913.1.13650 WP_001050913.1.13654 WP_001050913.1.13665 WP_001050913.1.13668 WP_001050913.1.13670 WP_001050913.1.13680 WP_001050913.1.13683 WP_001050913.1.13696 WP_001050913.1.13709 WP_001050913.1.13727 WP_001050913.1.13728 WP_001050913.1.13733 WP_001050913.1.13734 WP_001050913.1.1374 WP_001050913.1.1375 WP_001050913.1.13755 WP_001050913.1.13757 WP_001050913.1.13769 WP_001050913.1.13772 WP_001050913.1.13787 WP_001050913.1.13804 WP_001050913.1.13805 WP_001050913.1.13807 WP_001050913.1.13831 WP_001050913.1.13870 WP_001050913.1.13879 WP_001050913.1.13884 WP_001050913.1.13897 WP_001050913.1.13904 WP_001050913.1.13914 WP_001050913.1.13933 WP_001050913.1.13940 WP_001050913.1.13947 WP_001050913.1.13948 WP_001050913.1.13983 WP_001050913.1.13986 WP_001050913.1.13987 WP_001050913.1.14010 WP_001050913.1.14025 WP_001050913.1.14034 WP_001050913.1.14071 WP_001050913.1.14076 WP_001050913.1.14097 WP_001050913.1.14112 WP_001050913.1.14143 WP_001050913.1.14153 WP_001050913.1.14163 WP_001050913.1.1418 WP_001050913.1.14192 WP_001050913.1.1420 WP_001050913.1.14201 WP_001050913.1.14221 WP_001050913.1.14233 WP_001050913.1.1425 WP_001050913.1.1426 WP_001050913.1.14272 WP_001050913.1.14281 WP_001050913.1.1429 WP_001050913.1.14298 WP_001050913.1.14302 WP_001050913.1.14305 WP_001050913.1.14314 WP_001050913.1.14337 WP_001050913.1.14342 WP_001050913.1.14349 WP_001050913.1.14355 WP_001050913.1.14358 WP_001050913.1.14363 WP_001050913.1.14364 WP_001050913.1.14366 WP_001050913.1.14372 WP_001050913.1.14394 WP_001050913.1.14397 WP_001050913.1.14412 WP_001050913.1.14418 WP_001050913.1.14475 WP_001050913.1.14535 WP_001050913.1.1457 WP_001050913.1.14577 WP_001050913.1.14590 WP_001050913.1.14596 WP_001050913.1.14639 WP_001050913.1.14665 WP_001050913.1.14666 WP_001050913.1.1468 WP_001050913.1.14681 WP_001050913.1.14696 WP_001050913.1.147 WP_001050913.1.1471 WP_001050913.1.14729 WP_001050913.1.14734 WP_001050913.1.14744 WP_001050913.1.14747 WP_001050913.1.1477 WP_001050913.1.14770 WP_001050913.1.14774 WP_001050913.1.14782 WP_001050913.1.14787 WP_001050913.1.14790 WP_001050913.1.14809 WP_001050913.1.14823 WP_001050913.1.14825 WP_001050913.1.14846 WP_001050913.1.14866 WP_001050913.1.14868 WP_001050913.1.14869 WP_001050913.1.14874 WP_001050913.1.14888 WP_001050913.1.1490 WP_001050913.1.14902 WP_001050913.1.14924 WP_001050913.1.14970 WP_001050913.1.14987 WP_001050913.1.15000 WP_001050913.1.15015 WP_001050913.1.15022 WP_001050913.1.15029 WP_001050913.1.15039 WP_001050913.1.15071 WP_001050913.1.15091 WP_001050913.1.15098 WP_001050913.1.15108 WP_001050913.1.15150 WP_001050913.1.15173 WP_001050913.1.15182 WP_001050913.1.15185 WP_001050913.1.1520 WP_001050913.1.15201 WP_001050913.1.15206 WP_001050913.1.15234 WP_001050913.1.15241 WP_001050913.1.1525 WP_001050913.1.15255 WP_001050913.1.15263 WP_001050913.1.15268 WP_001050913.1.15269 WP_001050913.1.15278 WP_001050913.1.15294 WP_001050913.1.15296 WP_001050913.1.15329 WP_001050913.1.15389 WP_001050913.1.15399 WP_001050913.1.15403 WP_001050913.1.15409 WP_001050913.1.15438 WP_001050913.1.1545 WP_001050913.1.15478 WP_001050913.1.15489 WP_001050913.1.15505 WP_001050913.1.15507 WP_001050913.1.15519 WP_001050913.1.15524 WP_001050913.1.15532 WP_001050913.1.15533 WP_001050913.1.15544 WP_001050913.1.15546 WP_001050913.1.15554 WP_001050913.1.15572 WP_001050913.1.1558 WP_001050913.1.15590 WP_001050913.1.15591 WP_001050913.1.15601 WP_001050913.1.1562 WP_001050913.1.1564 WP_001050913.1.15641 WP_001050913.1.15679 WP_001050913.1.15687 WP_001050913.1.1569 WP_001050913.1.15691 WP_001050913.1.15706 WP_001050913.1.15712 WP_001050913.1.15722 WP_001050913.1.15753 WP_001050913.1.1579 WP_001050913.1.15812 WP_001050913.1.15818 WP_001050913.1.15819 WP_001050913.1.1583 WP_001050913.1.15838 WP_001050913.1.15883 WP_001050913.1.15888 WP_001050913.1.15892 WP_001050913.1.15897 WP_001050913.1.15898 WP_001050913.1.159 WP_001050913.1.15920 WP_001050913.1.15921 WP_001050913.1.15925 WP_001050913.1.15928 WP_001050913.1.15939 WP_001050913.1.15948 WP_001050913.1.15957 WP_001050913.1.15972 WP_001050913.1.1599 WP_001050913.1.1600 WP_001050913.1.16018 WP_001050913.1.16026 WP_001050913.1.1606 WP_001050913.1.16068 WP_001050913.1.16083 WP_001050913.1.16095 WP_001050913.1.16096 WP_001050913.1.16098 WP_001050913.1.16112 WP_001050913.1.16114 WP_001050913.1.16140 WP_001050913.1.16173 WP_001050913.1.16195 WP_001050913.1.16203 WP_001050913.1.16213 WP_001050913.1.16214 WP_001050913.1.16223 WP_001050913.1.1623 WP_001050913.1.16237 WP_001050913.1.16251 WP_001050913.1.16265 WP_001050913.1.16276 WP_001050913.1.16283 WP_001050913.1.16311 WP_001050913.1.16362 WP_001050913.1.16372 WP_001050913.1.16395 WP_001050913.1.16399 WP_001050913.1.16407 WP_001050913.1.16414 WP_001050913.1.16417 WP_001050913.1.16433 WP_001050913.1.16436 WP_001050913.1.16455 WP_001050913.1.16458 WP_001050913.1.16467 WP_001050913.1.16478 WP_001050913.1.16554 WP_001050913.1.16564 WP_001050913.1.16569 WP_001050913.1.16589 WP_001050913.1.16603 WP_001050913.1.16606 WP_001050913.1.16617 WP_001050913.1.1662 WP_001050913.1.16628 WP_001050913.1.16632 WP_001050913.1.16639 WP_001050913.1.16649 WP_001050913.1.16651 WP_001050913.1.16653 WP_001050913.1.1666 WP_001050913.1.16664 WP_001050913.1.16684 WP_001050913.1.16688 WP_001050913.1.16693 WP_001050913.1.16703 WP_001050913.1.16747 WP_001050913.1.16761 WP_001050913.1.16762 WP_001050913.1.16768 WP_001050913.1.16770 WP_001050913.1.16776 WP_001050913.1.16794 WP_001050913.1.16815 WP_001050913.1.16824 WP_001050913.1.16833 WP_001050913.1.16880 WP_001050913.1.16882 WP_001050913.1.16892 WP_001050913.1.16920 WP_001050913.1.16925 WP_001050913.1.16936 WP_001050913.1.16938 WP_001050913.1.16946 WP_001050913.1.16969 WP_001050913.1.16986 WP_001050913.1.170 WP_001050913.1.17009 WP_001050913.1.17012 WP_001050913.1.17038 WP_001050913.1.17046 WP_001050913.1.17050 WP_001050913.1.17080 WP_001050913.1.17104 WP_001050913.1.17122 WP_001050913.1.17132 WP_001050913.1.17137 WP_001050913.1.17139 WP_001050913.1.17143 WP_001050913.1.17156 WP_001050913.1.17157 WP_001050913.1.17169 WP_001050913.1.17176 WP_001050913.1.17180 WP_001050913.1.17193 WP_001050913.1.17200 WP_001050913.1.17201 WP_001050913.1.17210 WP_001050913.1.17231 WP_001050913.1.17234 WP_001050913.1.17240 WP_001050913.1.17248 WP_001050913.1.17249 WP_001050913.1.1725 WP_001050913.1.17256 WP_001050913.1.17289 WP_001050913.1.1729 WP_001050913.1.17296 WP_001050913.1.17309 WP_001050913.1.17320 WP_001050913.1.17327 WP_001050913.1.1736 WP_001050913.1.1740 WP_001050913.1.1741 WP_001050913.1.17419 WP_001050913.1.17450 WP_001050913.1.17454 WP_001050913.1.17456 WP_001050913.1.17475 WP_001050913.1.17485 WP_001050913.1.1751 WP_001050913.1.17524 WP_001050913.1.17526 WP_001050913.1.17529 WP_001050913.1.17531 WP_001050913.1.1756 WP_001050913.1.17569 WP_001050913.1.17581 WP_001050913.1.17590 WP_001050913.1.17628 WP_001050913.1.17643 WP_001050913.1.1765 WP_001050913.1.17651 WP_001050913.1.17657 WP_001050913.1.17658 WP_001050913.1.17666 WP_001050913.1.17676 WP_001050913.1.1771 WP_001050913.1.17717 WP_001050913.1.17718 WP_001050913.1.17720 WP_001050913.1.17725 WP_001050913.1.17729 WP_001050913.1.17737 WP_001050913.1.17770 WP_001050913.1.17796 WP_001050913.1.17818 WP_001050913.1.17834 WP_001050913.1.17835 WP_001050913.1.17838 WP_001050913.1.17845 WP_001050913.1.17847 WP_001050913.1.17853 WP_001050913.1.17859 WP_001050913.1.1787 WP_001050913.1.17876 WP_001050913.1.17882 WP_001050913.1.17909 WP_001050913.1.17922 WP_001050913.1.17928 WP_001050913.1.17929 WP_001050913.1.17943 WP_001050913.1.17951 WP_001050913.1.17966 WP_001050913.1.17974 WP_001050913.1.17987 WP_001050913.1.18011 WP_001050913.1.18016 WP_001050913.1.18035 WP_001050913.1.18043 WP_001050913.1.18069 WP_001050913.1.18074 WP_001050913.1.18080 WP_001050913.1.18105 WP_001050913.1.1811 WP_001050913.1.18113 WP_001050913.1.18132 WP_001050913.1.18140 WP_001050913.1.18153 WP_001050913.1.18203 WP_001050913.1.18205 WP_001050913.1.18237 WP_001050913.1.18248 WP_001050913.1.18261 WP_001050913.1.18273 WP_001050913.1.18283 WP_001050913.1.18288 WP_001050913.1.1829 WP_001050913.1.18290 WP_001050913.1.18301 WP_001050913.1.18309 WP_001050913.1.18310 WP_001050913.1.18320 WP_001050913.1.18346 WP_001050913.1.1835 WP_001050913.1.18360 WP_001050913.1.18437 WP_001050913.1.18451 WP_001050913.1.18466 WP_001050913.1.1847 WP_001050913.1.1849 WP_001050913.1.18495 WP_001050913.1.18497 WP_001050913.1.185 WP_001050913.1.18504 WP_001050913.1.18506 WP_001050913.1.1851 WP_001050913.1.18516 WP_001050913.1.18526 WP_001050913.1.18527 WP_001050913.1.18529 WP_001050913.1.18539 WP_001050913.1.18545 WP_001050913.1.18560 WP_001050913.1.18562 WP_001050913.1.18566 WP_001050913.1.18567 WP_001050913.1.18570 WP_001050913.1.18590 WP_001050913.1.18591 WP_001050913.1.18605 WP_001050913.1.18611 WP_001050913.1.18632 WP_001050913.1.18656 WP_001050913.1.18658 WP_001050913.1.18668 WP_001050913.1.18679 WP_001050913.1.18719 WP_001050913.1.18741 WP_001050913.1.18758 WP_001050913.1.18763 WP_001050913.1.18774 WP_001050913.1.18777 WP_001050913.1.18779 WP_001050913.1.18792 WP_001050913.1.18799 WP_001050913.1.18809 WP_001050913.1.18819 WP_001050913.1.18830 WP_001050913.1.18834 WP_001050913.1.18836 WP_001050913.1.18870 WP_001050913.1.18879 WP_001050913.1.18882 WP_001050913.1.18918 WP_001050913.1.1892 WP_001050913.1.18938 WP_001050913.1.18963 WP_001050913.1.18965 WP_001050913.1.18968 WP_001050913.1.18974 WP_001050913.1.18987 WP_001050913.1.18996 WP_001050913.1.19009 WP_001050913.1.1901 WP_001050913.1.19014 WP_001050913.1.19022 WP_001050913.1.19027 WP_001050913.1.19052 WP_001050913.1.19082 WP_001050913.1.19102 WP_001050913.1.19109 WP_001050913.1.1911 WP_001050913.1.1912 WP_001050913.1.19149 WP_001050913.1.192 WP_001050913.1.1921 WP_001050913.1.19259 WP_001050913.1.19272 WP_001050913.1.19301 WP_001050913.1.19306 WP_001050913.1.19322 WP_001050913.1.19365 WP_001050913.1.19370 WP_001050913.1.19375 WP_001050913.1.19377 WP_001050913.1.19386 WP_001050913.1.19399 WP_001050913.1.1940 WP_001050913.1.19411 WP_001050913.1.1943 WP_001050913.1.19430 WP_001050913.1.19444 WP_001050913.1.19450 WP_001050913.1.19455 WP_001050913.1.19497 WP_001050913.1.19509 WP_001050913.1.19515 WP_001050913.1.19537 WP_001050913.1.19555 WP_001050913.1.19575 WP_001050913.1.19577 WP_001050913.1.19611 WP_001050913.1.1962 WP_001050913.1.1964 WP_001050913.1.19643 WP_001050913.1.19653 WP_001050913.1.19700 WP_001050913.1.19701 WP_001050913.1.19717 WP_001050913.1.19725 WP_001050913.1.19732 WP_001050913.1.19733 WP_001050913.1.1974 WP_001050913.1.19748 WP_001050913.1.1975 WP_001050913.1.19759 WP_001050913.1.19765 WP_001050913.1.19775 WP_001050913.1.19788 WP_001050913.1.19792 WP_001050913.1.19801 WP_001050913.1.19816 WP_001050913.1.19848 WP_001050913.1.19881 WP_001050913.1.19904 WP_001050913.1.19905 WP_001050913.1.19921 WP_001050913.1.19928 WP_001050913.1.19968 WP_001050913.1.19977 WP_001050913.1.19980 WP_001050913.1.19981 WP_001050913.1.19982 WP_001050913.1.2 WP_001050913.1.20006 WP_001050913.1.20049 WP_001050913.1.20057 WP_001050913.1.2007 WP_001050913.1.2008 WP_001050913.1.20090 WP_001050913.1.20100 WP_001050913.1.20101 WP_001050913.1.2013 WP_001050913.1.20155 WP_001050913.1.20156 WP_001050913.1.20160 WP_001050913.1.20161 WP_001050913.1.20167 WP_001050913.1.20177 WP_001050913.1.20191 WP_001050913.1.20201 WP_001050913.1.20210 WP_001050913.1.20214 WP_001050913.1.20219 WP_001050913.1.20221 WP_001050913.1.20235 WP_001050913.1.20245 WP_001050913.1.2025 WP_001050913.1.20265 WP_001050913.1.2029 WP_001050913.1.20307 WP_001050913.1.20324 WP_001050913.1.20340 WP_001050913.1.20358 WP_001050913.1.20386 WP_001050913.1.20394 WP_001050913.1.20398 WP_001050913.1.20399 WP_001050913.1.20411 WP_001050913.1.20447 WP_001050913.1.20473 WP_001050913.1.20479 WP_001050913.1.20496 WP_001050913.1.20500 WP_001050913.1.20512 WP_001050913.1.20550 WP_001050913.1.20554 WP_001050913.1.20558 WP_001050913.1.2056 WP_001050913.1.20574 WP_001050913.1.20585 WP_001050913.1.20598 WP_001050913.1.20611 WP_001050913.1.20618 WP_001050913.1.20619 WP_001050913.1.20620 WP_001050913.1.20649 WP_001050913.1.20661 WP_001050913.1.20690 WP_001050913.1.20698 WP_001050913.1.20772 WP_001050913.1.2079 WP_001050913.1.20796 WP_001050913.1.20833 WP_001050913.1.20838 WP_001050913.1.20860 WP_001050913.1.20866 WP_001050913.1.20867 WP_001050913.1.20878 WP_001050913.1.20906 WP_001050913.1.20913 WP_001050913.1.20922 WP_001050913.1.20935 WP_001050913.1.20939 WP_001050913.1.20945 WP_001050913.1.20971 WP_001050913.1.20975 WP_001050913.1.20979 WP_001050913.1.21013 WP_001050913.1.21015 WP_001050913.1.21031 WP_001050913.1.21036 WP_001050913.1.21054 WP_001050913.1.21056 WP_001050913.1.21064 WP_001050913.1.21066 WP_001050913.1.21078 WP_001050913.1.21080 WP_001050913.1.21102 WP_001050913.1.21109 WP_001050913.1.21111 WP_001050913.1.21140 WP_001050913.1.21154 WP_001050913.1.21183 WP_001050913.1.2119 WP_001050913.1.21222 WP_001050913.1.21259 WP_001050913.1.21272 WP_001050913.1.2128 WP_001050913.1.2129 WP_001050913.1.21312 WP_001050913.1.21313 WP_001050913.1.21314 WP_001050913.1.21330 WP_001050913.1.21339 WP_001050913.1.2135 WP_001050913.1.21356 WP_001050913.1.21359 WP_001050913.1.21375 WP_001050913.1.21379 WP_001050913.1.21386 WP_001050913.1.21393 WP_001050913.1.21402 WP_001050913.1.21412 WP_001050913.1.21416 WP_001050913.1.21449 WP_001050913.1.21458 WP_001050913.1.21464 WP_001050913.1.21465 WP_001050913.1.21477 WP_001050913.1.21480 WP_001050913.1.21500 WP_001050913.1.21505 WP_001050913.1.21511 WP_001050913.1.21514 WP_001050913.1.2154 WP_001050913.1.21572 WP_001050913.1.21583 WP_001050913.1.21589 WP_001050913.1.2159 WP_001050913.1.2160 WP_001050913.1.21601 WP_001050913.1.21621 WP_001050913.1.21636 WP_001050913.1.21679 WP_001050913.1.21712 WP_001050913.1.21719 WP_001050913.1.21724 WP_001050913.1.21746 WP_001050913.1.21763 WP_001050913.1.2178 WP_001050913.1.21787 WP_001050913.1.21820 WP_001050913.1.21828 WP_001050913.1.21830 WP_001050913.1.21890 WP_001050913.1.21894 WP_001050913.1.21900 WP_001050913.1.21901 WP_001050913.1.21919 WP_001050913.1.21954 WP_001050913.1.21985 WP_001050913.1.21988 WP_001050913.1.2200 WP_001050913.1.22000 WP_001050913.1.22011 WP_001050913.1.22022 WP_001050913.1.22027 WP_001050913.1.22033 WP_001050913.1.22038 WP_001050913.1.22045 WP_001050913.1.22049 WP_001050913.1.22065 WP_001050913.1.22082 WP_001050913.1.22093 WP_001050913.1.2211 WP_001050913.1.22111 WP_001050913.1.22149 WP_001050913.1.22163 WP_001050913.1.22164 WP_001050913.1.22165 WP_001050913.1.22170 WP_001050913.1.22174 WP_001050913.1.22177 WP_001050913.1.22180 WP_001050913.1.22197 WP_001050913.1.22200 WP_001050913.1.22246 WP_001050913.1.22259 WP_001050913.1.22307 WP_001050913.1.22344 WP_001050913.1.22367 WP_001050913.1.22369 WP_001050913.1.22400 WP_001050913.1.22418 WP_001050913.1.22419 WP_001050913.1.22426 WP_001050913.1.22441 WP_001050913.1.22493 WP_001050913.1.22498 WP_001050913.1.22512 WP_001050913.1.22526 WP_001050913.1.22531 WP_001050913.1.22533 WP_001050913.1.22547 WP_001050913.1.22551 WP_001050913.1.22559 WP_001050913.1.22650 WP_001050913.1.22657 WP_001050913.1.22684 WP_001050913.1.22696 WP_001050913.1.22702 WP_001050913.1.22709 WP_001050913.1.22714 WP_001050913.1.22727 WP_001050913.1.22730 WP_001050913.1.22731 WP_001050913.1.22738 WP_001050913.1.22739 WP_001050913.1.22764 WP_001050913.1.22787 WP_001050913.1.22789 WP_001050913.1.22790 WP_001050913.1.22792 WP_001050913.1.2280 WP_001050913.1.22803 WP_001050913.1.22808 WP_001050913.1.22811 WP_001050913.1.22826 WP_001050913.1.22843 WP_001050913.1.22853 WP_001050913.1.22861 WP_001050913.1.22869 WP_001050913.1.22890 WP_001050913.1.22924 WP_001050913.1.22969 WP_001050913.1.22975 WP_001050913.1.22983 WP_001050913.1.22984 WP_001050913.1.22994 WP_001050913.1.23004 WP_001050913.1.23012 WP_001050913.1.23048 WP_001050913.1.23061 WP_001050913.1.23069 WP_001050913.1.23082 WP_001050913.1.23103 WP_001050913.1.23121 WP_001050913.1.23130 WP_001050913.1.23132 WP_001050913.1.23133 WP_001050913.1.23146 WP_001050913.1.23152 WP_001050913.1.23161 WP_001050913.1.23185 WP_001050913.1.23194 WP_001050913.1.23197 WP_001050913.1.23217 WP_001050913.1.23222 WP_001050913.1.23228 WP_001050913.1.23238 WP_001050913.1.23244 WP_001050913.1.23251 WP_001050913.1.2327 WP_001050913.1.23275 WP_001050913.1.23288 WP_001050913.1.23304 WP_001050913.1.23381 WP_001050913.1.23413 WP_001050913.1.23420 WP_001050913.1.23431 WP_001050913.1.23439 WP_001050913.1.23449 WP_001050913.1.23450 WP_001050913.1.23476 WP_001050913.1.23491 WP_001050913.1.23516 WP_001050913.1.23517 WP_001050913.1.23531 WP_001050913.1.23541 WP_001050913.1.23544 WP_001050913.1.23557 WP_001050913.1.23568 WP_001050913.1.23572 WP_001050913.1.23580 WP_001050913.1.23586 WP_001050913.1.23613 WP_001050913.1.23617 WP_001050913.1.23626 WP_001050913.1.23630 WP_001050913.1.23644 WP_001050913.1.23671 WP_001050913.1.23690 WP_001050913.1.23708 WP_001050913.1.23710 WP_001050913.1.23730 WP_001050913.1.23740 WP_001050913.1.23796 WP_001050913.1.2382 WP_001050913.1.23822 WP_001050913.1.23842 WP_001050913.1.23849 WP_001050913.1.23856 WP_001050913.1.2389 WP_001050913.1.23896 WP_001050913.1.23900 WP_001050913.1.23902 WP_001050913.1.23907 WP_001050913.1.23926 WP_001050913.1.23935 WP_001050913.1.23944 WP_001050913.1.23956 WP_001050913.1.23972 WP_001050913.1.23995 WP_001050913.1.23998 WP_001050913.1.24000 WP_001050913.1.24081 WP_001050913.1.24129 WP_001050913.1.24148 WP_001050913.1.24154 WP_001050913.1.24167 WP_001050913.1.24174 WP_001050913.1.2420 WP_001050913.1.24207 WP_001050913.1.24213 WP_001050913.1.24226 WP_001050913.1.2423 WP_001050913.1.24241 WP_001050913.1.24263 WP_001050913.1.2427 WP_001050913.1.24275 WP_001050913.1.24276 WP_001050913.1.24277 WP_001050913.1.24279 WP_001050913.1.24286 WP_001050913.1.24302 WP_001050913.1.2434 WP_001050913.1.24343 WP_001050913.1.24347 WP_001050913.1.24364 WP_001050913.1.24365 WP_001050913.1.24388 WP_001050913.1.24416 WP_001050913.1.24418 WP_001050913.1.2442 WP_001050913.1.24436 WP_001050913.1.24437 WP_001050913.1.24439 WP_001050913.1.24443 WP_001050913.1.24462 WP_001050913.1.24469 WP_001050913.1.24478 WP_001050913.1.2450 WP_001050913.1.24502 WP_001050913.1.24503 WP_001050913.1.24516 WP_001050913.1.24519 WP_001050913.1.24569 WP_001050913.1.24572 WP_001050913.1.2458 WP_001050913.1.24589 WP_001050913.1.24596 WP_001050913.1.24597 WP_001050913.1.24617 WP_001050913.1.24625 WP_001050913.1.24631 WP_001050913.1.24654 WP_001050913.1.24674 WP_001050913.1.24679 WP_001050913.1.24681 WP_001050913.1.24684 WP_001050913.1.24685 WP_001050913.1.24702 WP_001050913.1.24711 WP_001050913.1.24714 WP_001050913.1.24745 WP_001050913.1.24780 WP_001050913.1.24781 WP_001050913.1.2480 WP_001050913.1.24802 WP_001050913.1.24817 WP_001050913.1.24823 WP_001050913.1.24834 WP_001050913.1.24855 WP_001050913.1.24856 WP_001050913.1.24891 WP_001050913.1.24903 WP_001050913.1.24918 WP_001050913.1.24937 WP_001050913.1.2497 WP_001050913.1.24996 WP_001050913.1.25001 WP_001050913.1.25007 WP_001050913.1.2501 WP_001050913.1.25012 WP_001050913.1.25029 WP_001050913.1.2506 WP_001050913.1.25070 WP_001050913.1.25083 WP_001050913.1.25092 WP_001050913.1.25095 WP_001050913.1.25098 WP_001050913.1.25115 WP_001050913.1.25117 WP_001050913.1.25120 WP_001050913.1.25145 WP_001050913.1.25167 WP_001050913.1.25170 WP_001050913.1.25187 WP_001050913.1.25209 WP_001050913.1.25216 WP_001050913.1.2522 WP_001050913.1.25221 WP_001050913.1.25262 WP_001050913.1.25287 WP_001050913.1.25288 WP_001050913.1.25331 WP_001050913.1.25341 WP_001050913.1.25345 WP_001050913.1.25361 WP_001050913.1.25433 WP_001050913.1.25438 WP_001050913.1.2544 WP_001050913.1.25459 WP_001050913.1.25469 WP_001050913.1.25479 WP_001050913.1.25488 WP_001050913.1.25489 WP_001050913.1.25495 WP_001050913.1.25511 WP_001050913.1.25557 WP_001050913.1.25567 WP_001050913.1.25569 WP_001050913.1.25591 WP_001050913.1.25593 WP_001050913.1.25595 WP_001050913.1.25597 WP_001050913.1.25621 WP_001050913.1.25623 WP_001050913.1.25633 WP_001050913.1.25634 WP_001050913.1.25651 WP_001050913.1.257 WP_001050913.1.25721 WP_001050913.1.25732 WP_001050913.1.25737 WP_001050913.1.25744 WP_001050913.1.25758 WP_001050913.1.25770 WP_001050913.1.25772 WP_001050913.1.25776 WP_001050913.1.25779 WP_001050913.1.2579 WP_001050913.1.25801 WP_001050913.1.25802 WP_001050913.1.25820 WP_001050913.1.25840 WP_001050913.1.25852 WP_001050913.1.25856 WP_001050913.1.25857 WP_001050913.1.25868 WP_001050913.1.25881 WP_001050913.1.25891 WP_001050913.1.2590 WP_001050913.1.25910 WP_001050913.1.2592 WP_001050913.1.25924 WP_001050913.1.25929 WP_001050913.1.2593 WP_001050913.1.25930 WP_001050913.1.25955 WP_001050913.1.25984 WP_001050913.1.26006 WP_001050913.1.26012 WP_001050913.1.26015 WP_001050913.1.26033 WP_001050913.1.26039 WP_001050913.1.26050 WP_001050913.1.26058 WP_001050913.1.2608 WP_001050913.1.26086 WP_001050913.1.26094 WP_001050913.1.26106 WP_001050913.1.26143 WP_001050913.1.26169 WP_001050913.1.26172 WP_001050913.1.2619 WP_001050913.1.26226 WP_001050913.1.26255 WP_001050913.1.26266 WP_001050913.1.26271 WP_001050913.1.26276 WP_001050913.1.26283 WP_001050913.1.26289 WP_001050913.1.26290 WP_001050913.1.26293 WP_001050913.1.26298 WP_001050913.1.26306 WP_001050913.1.26307 WP_001050913.1.26314 WP_001050913.1.26318 WP_001050913.1.2633 WP_001050913.1.26340 WP_001050913.1.26345 WP_001050913.1.26346 WP_001050913.1.26354 WP_001050913.1.26359 WP_001050913.1.26364 WP_001050913.1.26370 WP_001050913.1.26397 WP_001050913.1.26399 WP_001050913.1.26404 WP_001050913.1.26405 WP_001050913.1.26424 WP_001050913.1.2643 WP_001050913.1.26431 WP_001050913.1.2645 WP_001050913.1.26481 WP_001050913.1.26506 WP_001050913.1.26533 WP_001050913.1.26555 WP_001050913.1.2656 WP_001050913.1.2658 WP_001050913.1.26584 WP_001050913.1.2661 WP_001050913.1.26626 WP_001050913.1.2664 WP_001050913.1.26650 WP_001050913.1.26662 WP_001050913.1.26663 WP_001050913.1.26664 WP_001050913.1.26677 WP_001050913.1.26692 WP_001050913.1.26713 WP_001050913.1.26726 WP_001050913.1.2673 WP_001050913.1.26733 WP_001050913.1.2674 WP_001050913.1.26749 WP_001050913.1.26751 WP_001050913.1.26771 WP_001050913.1.26772 WP_001050913.1.26773 WP_001050913.1.26778 WP_001050913.1.26790 WP_001050913.1.2680 WP_001050913.1.26804 WP_001050913.1.2684 WP_001050913.1.26840 WP_001050913.1.26850 WP_001050913.1.26864 WP_001050913.1.26865 WP_001050913.1.2687 WP_001050913.1.26884 WP_001050913.1.26886 WP_001050913.1.2689 WP_001050913.1.26903 WP_001050913.1.26905 WP_001050913.1.26927 WP_001050913.1.26929 WP_001050913.1.26938 WP_001050913.1.26944 WP_001050913.1.26947 WP_001050913.1.26958 WP_001050913.1.26963 WP_001050913.1.2697 WP_001050913.1.27053 WP_001050913.1.27080 WP_001050913.1.27083 WP_001050913.1.27097 WP_001050913.1.2710 WP_001050913.1.27120 WP_001050913.1.27127 WP_001050913.1.27147 WP_001050913.1.27154 WP_001050913.1.27160 WP_001050913.1.27166 WP_001050913.1.27168 WP_001050913.1.27170 WP_001050913.1.2718 WP_001050913.1.27182 WP_001050913.1.2719 WP_001050913.1.27199 WP_001050913.1.27207 WP_001050913.1.27226 WP_001050913.1.27237 WP_001050913.1.27246 WP_001050913.1.2725 WP_001050913.1.27262 WP_001050913.1.27294 WP_001050913.1.27303 WP_001050913.1.27311 WP_001050913.1.27323 WP_001050913.1.27333 WP_001050913.1.2734 WP_001050913.1.27345 WP_001050913.1.27379 WP_001050913.1.27384 WP_001050913.1.27413 WP_001050913.1.27415 WP_001050913.1.2744 WP_001050913.1.27447 WP_001050913.1.27448 WP_001050913.1.27455 WP_001050913.1.27456 WP_001050913.1.27457 WP_001050913.1.27467 WP_001050913.1.27468 WP_001050913.1.27489 WP_001050913.1.27516 WP_001050913.1.27529 WP_001050913.1.2753 WP_001050913.1.27551 WP_001050913.1.27562 WP_001050913.1.2759 WP_001050913.1.27590 WP_001050913.1.27605 WP_001050913.1.27608 WP_001050913.1.27614 WP_001050913.1.27615 WP_001050913.1.27621 WP_001050913.1.27622 WP_001050913.1.27628 WP_001050913.1.27646 WP_001050913.1.27654 WP_001050913.1.27662 WP_001050913.1.27667 WP_001050913.1.27670 WP_001050913.1.27673 WP_001050913.1.27689 WP_001050913.1.27696 WP_001050913.1.27720 WP_001050913.1.27739 WP_001050913.1.27748 WP_001050913.1.27765 WP_001050913.1.27787 WP_001050913.1.27793 WP_001050913.1.27799 WP_001050913.1.27817 WP_001050913.1.27830 WP_001050913.1.27834 WP_001050913.1.27854 WP_001050913.1.27929 WP_001050913.1.2795 WP_001050913.1.27950 WP_001050913.1.27953 WP_001050913.1.27972 WP_001050913.1.27999 WP_001050913.1.2800 WP_001050913.1.28007 WP_001050913.1.28016 WP_001050913.1.28063 WP_001050913.1.28071 WP_001050913.1.28074 WP_001050913.1.28079 WP_001050913.1.2808 WP_001050913.1.28081 WP_001050913.1.28088 WP_001050913.1.28091 WP_001050913.1.28105 WP_001050913.1.28107 WP_001050913.1.28117 WP_001050913.1.28138 WP_001050913.1.28147 WP_001050913.1.28158 WP_001050913.1.28191 WP_001050913.1.28207 WP_001050913.1.28213 WP_001050913.1.28226 WP_001050913.1.28230 WP_001050913.1.28253 WP_001050913.1.28257 WP_001050913.1.28274 WP_001050913.1.28298 WP_001050913.1.28315 WP_001050913.1.28319 WP_001050913.1.28334 WP_001050913.1.28336 WP_001050913.1.28337 WP_001050913.1.28347 WP_001050913.1.28358 WP_001050913.1.28376 WP_001050913.1.28381 WP_001050913.1.28392 WP_001050913.1.28394 WP_001050913.1.28399 WP_001050913.1.2840 WP_001050913.1.28426 WP_001050913.1.28430 WP_001050913.1.28447 WP_001050913.1.28482 WP_001050913.1.28490 WP_001050913.1.28498 WP_001050913.1.28501 WP_001050913.1.28502 WP_001050913.1.2852 WP_001050913.1.28526 WP_001050913.1.28527 WP_001050913.1.28532 WP_001050913.1.28564 WP_001050913.1.28578 WP_001050913.1.28580 WP_001050913.1.28584 WP_001050913.1.28605 WP_001050913.1.28614 WP_001050913.1.2862 WP_001050913.1.28629 WP_001050913.1.28636 WP_001050913.1.28650 WP_001050913.1.28652 WP_001050913.1.28672 WP_001050913.1.28675 WP_001050913.1.28690 WP_001050913.1.28691 WP_001050913.1.28710 WP_001050913.1.28720 WP_001050913.1.28763 WP_001050913.1.28784 WP_001050913.1.28785 WP_001050913.1.28825 WP_001050913.1.28833 WP_001050913.1.28848 WP_001050913.1.28862 WP_001050913.1.28866 WP_001050913.1.28871 WP_001050913.1.28874 WP_001050913.1.28887 WP_001050913.1.28909 WP_001050913.1.2891 WP_001050913.1.28915 WP_001050913.1.28925 WP_001050913.1.28933 WP_001050913.1.28934 WP_001050913.1.28960 WP_001050913.1.28970 WP_001050913.1.28981 WP_001050913.1.28987 WP_001050913.1.29014 WP_001050913.1.29052 WP_001050913.1.2906 WP_001050913.1.29060 WP_001050913.1.29090 WP_001050913.1.29091 WP_001050913.1.29107 WP_001050913.1.29110 WP_001050913.1.29112 WP_001050913.1.2913 WP_001050913.1.29155 WP_001050913.1.29166 WP_001050913.1.29170 WP_001050913.1.29187 WP_001050913.1.29188 WP_001050913.1.29207 WP_001050913.1.29226 WP_001050913.1.29242 WP_001050913.1.29243 WP_001050913.1.29244 WP_001050913.1.29250 WP_001050913.1.29263 WP_001050913.1.29272 WP_001050913.1.29276 WP_001050913.1.29282 WP_001050913.1.29285 WP_001050913.1.29301 WP_001050913.1.29312 WP_001050913.1.29315 WP_001050913.1.29329 WP_001050913.1.29340 WP_001050913.1.29366 WP_001050913.1.29368 WP_001050913.1.29372 WP_001050913.1.29373 WP_001050913.1.29375 WP_001050913.1.29381 WP_001050913.1.29420 WP_001050913.1.29433 WP_001050913.1.29445 WP_001050913.1.29453 WP_001050913.1.29468 WP_001050913.1.29479 WP_001050913.1.29483 WP_001050913.1.29484 WP_001050913.1.29511 WP_001050913.1.29541 WP_001050913.1.29553 WP_001050913.1.29554 WP_001050913.1.29557 WP_001050913.1.29561 WP_001050913.1.2957 WP_001050913.1.29571 WP_001050913.1.29596 WP_001050913.1.29644 WP_001050913.1.29676 WP_001050913.1.29709 WP_001050913.1.29710 WP_001050913.1.29716 WP_001050913.1.2972 WP_001050913.1.29731 WP_001050913.1.29744 WP_001050913.1.2975 WP_001050913.1.29758 WP_001050913.1.29781 WP_001050913.1.29788 WP_001050913.1.29805 WP_001050913.1.2981 WP_001050913.1.29826 WP_001050913.1.2983 WP_001050913.1.29862 WP_001050913.1.29885 WP_001050913.1.29902 WP_001050913.1.29905 WP_001050913.1.29918 WP_001050913.1.29956 WP_001050913.1.29963 WP_001050913.1.2997 WP_001050913.1.29981 WP_001050913.1.29982 WP_001050913.1.30012 WP_001050913.1.30023 WP_001050913.1.30033 WP_001050913.1.30047 WP_001050913.1.30051 WP_001050913.1.30057 WP_001050913.1.30089 WP_001050913.1.30095 WP_001050913.1.30100 WP_001050913.1.30115 WP_001050913.1.3012 WP_001050913.1.30130 WP_001050913.1.30150 WP_001050913.1.30152 WP_001050913.1.30169 WP_001050913.1.30176 WP_001050913.1.30186 WP_001050913.1.30188 WP_001050913.1.30190 WP_001050913.1.30191 WP_001050913.1.30197 WP_001050913.1.30203 WP_001050913.1.30209 WP_001050913.1.30230 WP_001050913.1.30249 WP_001050913.1.30262 WP_001050913.1.30268 WP_001050913.1.30274 WP_001050913.1.3029 WP_001050913.1.30294 WP_001050913.1.30307 WP_001050913.1.30328 WP_001050913.1.30350 WP_001050913.1.30364 WP_001050913.1.30367 WP_001050913.1.30376 WP_001050913.1.30381 WP_001050913.1.30385 WP_001050913.1.30392 WP_001050913.1.30418 WP_001050913.1.30422 WP_001050913.1.30458 WP_001050913.1.30477 WP_001050913.1.30482 WP_001050913.1.30496 WP_001050913.1.3050 WP_001050913.1.30530 WP_001050913.1.30531 WP_001050913.1.30560 WP_001050913.1.30566 WP_001050913.1.30568 WP_001050913.1.30600 WP_001050913.1.30622 WP_001050913.1.30623 WP_001050913.1.30645 WP_001050913.1.30646 WP_001050913.1.30648 WP_001050913.1.30650 WP_001050913.1.30652 WP_001050913.1.30668 WP_001050913.1.30690 WP_001050913.1.30702 WP_001050913.1.30726 WP_001050913.1.30758 WP_001050913.1.30763 WP_001050913.1.3077 WP_001050913.1.30845 WP_001050913.1.30847 WP_001050913.1.30854 WP_001050913.1.30861 WP_001050913.1.30862 WP_001050913.1.30863 WP_001050913.1.30874 WP_001050913.1.30878 WP_001050913.1.30880 WP_001050913.1.30889 WP_001050913.1.30907 WP_001050913.1.30911 WP_001050913.1.30915 WP_001050913.1.30916 WP_001050913.1.30928 WP_001050913.1.30945 WP_001050913.1.30962 WP_001050913.1.3097 WP_001050913.1.30970 WP_001050913.1.30971 WP_001050913.1.30998 WP_001050913.1.31005 WP_001050913.1.31022 WP_001050913.1.31037 WP_001050913.1.31039 WP_001050913.1.31041 WP_001050913.1.31048 WP_001050913.1.31065 WP_001050913.1.31068 WP_001050913.1.31077 WP_001050913.1.31091 WP_001050913.1.31113 WP_001050913.1.31114 WP_001050913.1.31120 WP_001050913.1.31123 WP_001050913.1.31124 WP_001050913.1.31176 WP_001050913.1.31194 WP_001050913.1.31202 WP_001050913.1.31204 WP_001050913.1.31206 WP_001050913.1.31212 WP_001050913.1.31232 WP_001050913.1.31278 WP_001050913.1.31294 WP_001050913.1.31315 WP_001050913.1.3132 WP_001050913.1.31337 WP_001050913.1.31339 WP_001050913.1.31355 WP_001050913.1.31363 WP_001050913.1.31376 WP_001050913.1.31377 WP_001050913.1.31402 WP_001050913.1.31436 WP_001050913.1.31437 WP_001050913.1.31441 WP_001050913.1.31462 WP_001050913.1.31468 WP_001050913.1.31478 WP_001050913.1.31479 WP_001050913.1.31484 WP_001050913.1.31497 WP_001050913.1.315 WP_001050913.1.31505 WP_001050913.1.31529 WP_001050913.1.31531 WP_001050913.1.31539 WP_001050913.1.31567 WP_001050913.1.31568 WP_001050913.1.31589 WP_001050913.1.31605 WP_001050913.1.31611 WP_001050913.1.31621 WP_001050913.1.31638 WP_001050913.1.31642 WP_001050913.1.31647 WP_001050913.1.31653 WP_001050913.1.31667 WP_001050913.1.31686 WP_001050913.1.31701 WP_001050913.1.31743 WP_001050913.1.31753 WP_001050913.1.31787 WP_001050913.1.31791 WP_001050913.1.31797 WP_001050913.1.31806 WP_001050913.1.31817 WP_001050913.1.31827 WP_001050913.1.31828 WP_001050913.1.31842 WP_001050913.1.3188 WP_001050913.1.31892 WP_001050913.1.31897 WP_001050913.1.31925 WP_001050913.1.31931 WP_001050913.1.31949 WP_001050913.1.31994 WP_001050913.1.31997 WP_001050913.1.32003 WP_001050913.1.32005 WP_001050913.1.32029 WP_001050913.1.32040 WP_001050913.1.32059 WP_001050913.1.32067 WP_001050913.1.32077 WP_001050913.1.32106 WP_001050913.1.32118 WP_001050913.1.32122 WP_001050913.1.32125 WP_001050913.1.32130 WP_001050913.1.32160 WP_001050913.1.32167 WP_001050913.1.3219 WP_001050913.1.32207 WP_001050913.1.32215 WP_001050913.1.32217 WP_001050913.1.32244 WP_001050913.1.32248 WP_001050913.1.32269 WP_001050913.1.32270 WP_001050913.1.32281 WP_001050913.1.3229 WP_001050913.1.32295 WP_001050913.1.32301 WP_001050913.1.3231 WP_001050913.1.32325 WP_001050913.1.32338 WP_001050913.1.32339 WP_001050913.1.32340 WP_001050913.1.32348 WP_001050913.1.32365 WP_001050913.1.32384 WP_001050913.1.32405 WP_001050913.1.3242 WP_001050913.1.3244 WP_001050913.1.32464 WP_001050913.1.32474 WP_001050913.1.32481 WP_001050913.1.32483 WP_001050913.1.32497 WP_001050913.1.32514 WP_001050913.1.32517 WP_001050913.1.32534 WP_001050913.1.32546 WP_001050913.1.32555 WP_001050913.1.32565 WP_001050913.1.32584 WP_001050913.1.32588 WP_001050913.1.32599 WP_001050913.1.32607 WP_001050913.1.32634 WP_001050913.1.32636 WP_001050913.1.32645 WP_001050913.1.32671 WP_001050913.1.32739 WP_001050913.1.32746 WP_001050913.1.32754 WP_001050913.1.32761 WP_001050913.1.32763 WP_001050913.1.32764 WP_001050913.1.32795 WP_001050913.1.328 WP_001050913.1.32800 WP_001050913.1.32829 WP_001050913.1.32839 WP_001050913.1.32898 WP_001050913.1.32921 WP_001050913.1.32925 WP_001050913.1.32928 WP_001050913.1.3293 WP_001050913.1.32939 WP_001050913.1.32954 WP_001050913.1.32965 WP_001050913.1.32980 WP_001050913.1.32987 WP_001050913.1.3299 WP_001050913.1.3301 WP_001050913.1.33029 WP_001050913.1.33038 WP_001050913.1.33048 WP_001050913.1.3306 WP_001050913.1.33067 WP_001050913.1.33108 WP_001050913.1.33110 WP_001050913.1.33123 WP_001050913.1.33138 WP_001050913.1.33147 WP_001050913.1.3316 WP_001050913.1.33161 WP_001050913.1.33172 WP_001050913.1.33199 WP_001050913.1.33212 WP_001050913.1.33213 WP_001050913.1.33250 WP_001050913.1.33252 WP_001050913.1.33255 WP_001050913.1.33266 WP_001050913.1.33277 WP_001050913.1.33292 WP_001050913.1.33296 WP_001050913.1.3330 WP_001050913.1.33307 WP_001050913.1.33322 WP_001050913.1.33328 WP_001050913.1.33335 WP_001050913.1.3335 WP_001050913.1.33350 WP_001050913.1.33357 WP_001050913.1.33368 WP_001050913.1.3338 WP_001050913.1.33388 WP_001050913.1.3341 WP_001050913.1.33416 WP_001050913.1.3342 WP_001050913.1.3343 WP_001050913.1.33432 WP_001050913.1.3345 WP_001050913.1.33463 WP_001050913.1.33468 WP_001050913.1.3347 WP_001050913.1.33483 WP_001050913.1.33484 WP_001050913.1.33507 WP_001050913.1.33516 WP_001050913.1.33518 WP_001050913.1.33520 WP_001050913.1.33538 WP_001050913.1.33540 WP_001050913.1.33567 WP_001050913.1.3357 WP_001050913.1.33575 WP_001050913.1.3358 WP_001050913.1.33594 WP_001050913.1.33607 WP_001050913.1.33610 WP_001050913.1.33626 WP_001050913.1.33627 WP_001050913.1.3363 WP_001050913.1.33640 WP_001050913.1.33650 WP_001050913.1.33654 WP_001050913.1.33655 WP_001050913.1.33692 WP_001050913.1.33695 WP_001050913.1.33707 WP_001050913.1.33718 WP_001050913.1.33720 WP_001050913.1.33724 WP_001050913.1.33735 WP_001050913.1.33743 WP_001050913.1.33756 WP_001050913.1.33765 WP_001050913.1.33766 WP_001050913.1.33767 WP_001050913.1.33769 WP_001050913.1.33778 WP_001050913.1.33792 WP_001050913.1.33804 WP_001050913.1.33813 WP_001050913.1.33816 WP_001050913.1.33850 WP_001050913.1.33855 WP_001050913.1.33899 WP_001050913.1.33915 WP_001050913.1.33940 WP_001050913.1.33949 WP_001050913.1.33966 WP_001050913.1.33968 WP_001050913.1.33971 WP_001050913.1.33983 WP_001050913.1.33989 WP_001050913.1.33994 WP_001050913.1.34026 WP_001050913.1.34030 WP_001050913.1.34051 WP_001050913.1.34060 WP_001050913.1.34069 WP_001050913.1.34078 WP_001050913.1.34079 WP_001050913.1.34080 WP_001050913.1.34089 WP_001050913.1.34100 WP_001050913.1.34105 WP_001050913.1.34112 WP_001050913.1.34128 WP_001050913.1.34132 WP_001050913.1.34168 WP_001050913.1.34172 WP_001050913.1.3418 WP_001050913.1.34182 WP_001050913.1.34209 WP_001050913.1.3422 WP_001050913.1.34223 WP_001050913.1.34231 WP_001050913.1.34244 WP_001050913.1.34249 WP_001050913.1.34250 WP_001050913.1.34254 WP_001050913.1.34280 WP_001050913.1.34285 WP_001050913.1.34307 WP_001050913.1.34334 WP_001050913.1.34361 WP_001050913.1.34381 WP_001050913.1.34403 WP_001050913.1.34410 WP_001050913.1.3442 WP_001050913.1.34427 WP_001050913.1.34436 WP_001050913.1.34471 WP_001050913.1.34473 WP_001050913.1.34482 WP_001050913.1.34492 WP_001050913.1.34502 WP_001050913.1.34510 WP_001050913.1.34512 WP_001050913.1.34526 WP_001050913.1.34531 WP_001050913.1.34569 WP_001050913.1.34578 WP_001050913.1.3461 WP_001050913.1.34620 WP_001050913.1.34626 WP_001050913.1.34666 WP_001050913.1.34677 WP_001050913.1.34716 WP_001050913.1.34723 WP_001050913.1.34733 WP_001050913.1.34737 WP_001050913.1.3474 WP_001050913.1.34741 WP_001050913.1.34767 WP_001050913.1.34774 WP_001050913.1.34818 WP_001050913.1.34865 WP_001050913.1.34877 WP_001050913.1.34890 WP_001050913.1.34912 WP_001050913.1.34918 WP_001050913.1.34923 WP_001050913.1.34926 WP_001050913.1.34943 WP_001050913.1.34967 WP_001050913.1.34970 WP_001050913.1.34998 WP_001050913.1.35031 WP_001050913.1.35032 WP_001050913.1.35054 WP_001050913.1.35059 WP_001050913.1.35062 WP_001050913.1.35089 WP_001050913.1.35097 WP_001050913.1.35106 WP_001050913.1.35108 WP_001050913.1.35110 WP_001050913.1.35121 WP_001050913.1.35177 WP_001050913.1.35182 WP_001050913.1.35189 WP_001050913.1.35194 WP_001050913.1.35222 WP_001050913.1.35233 WP_001050913.1.35243 WP_001050913.1.35257 WP_001050913.1.3526 WP_001050913.1.35264 WP_001050913.1.35276 WP_001050913.1.35285 WP_001050913.1.35289 WP_001050913.1.35297 WP_001050913.1.35307 WP_001050913.1.35314 WP_001050913.1.35334 WP_001050913.1.35340 WP_001050913.1.35342 WP_001050913.1.35345 WP_001050913.1.35352 WP_001050913.1.35391 WP_001050913.1.354 WP_001050913.1.35413 WP_001050913.1.35415 WP_001050913.1.3542 WP_001050913.1.35423 WP_001050913.1.35433 WP_001050913.1.35435 WP_001050913.1.3547 WP_001050913.1.3549 WP_001050913.1.35490 WP_001050913.1.35497 WP_001050913.1.35498 WP_001050913.1.35506 WP_001050913.1.35508 WP_001050913.1.35517 WP_001050913.1.35519 WP_001050913.1.3552 WP_001050913.1.35525 WP_001050913.1.35549 WP_001050913.1.35580 WP_001050913.1.35615 WP_001050913.1.35623 WP_001050913.1.35642 WP_001050913.1.35643 WP_001050913.1.35659 WP_001050913.1.35661 WP_001050913.1.35673 WP_001050913.1.35686 WP_001050913.1.3569 WP_001050913.1.35696 WP_001050913.1.35730 WP_001050913.1.3574 WP_001050913.1.35742 WP_001050913.1.35746 WP_001050913.1.35774 WP_001050913.1.35784 WP_001050913.1.3579 WP_001050913.1.35794 WP_001050913.1.35799 WP_001050913.1.35801 WP_001050913.1.35826 WP_001050913.1.35888 WP_001050913.1.35890 WP_001050913.1.35900 WP_001050913.1.35928 WP_001050913.1.35950 WP_001050913.1.35958 WP_001050913.1.36004 WP_001050913.1.36021 WP_001050913.1.36041 WP_001050913.1.36082 WP_001050913.1.36093 WP_001050913.1.36102 WP_001050913.1.3611 WP_001050913.1.36117 WP_001050913.1.36119 WP_001050913.1.36141 WP_001050913.1.3617 WP_001050913.1.36175 WP_001050913.1.36176 WP_001050913.1.36179 WP_001050913.1.36187 WP_001050913.1.36188 WP_001050913.1.36193 WP_001050913.1.36208 WP_001050913.1.36211 WP_001050913.1.36220 WP_001050913.1.36223 WP_001050913.1.3623 WP_001050913.1.36231 WP_001050913.1.36249 WP_001050913.1.36250 WP_001050913.1.36264 WP_001050913.1.36278 WP_001050913.1.36282 WP_001050913.1.36283 WP_001050913.1.36302 WP_001050913.1.36307 WP_001050913.1.36325 WP_001050913.1.36344 WP_001050913.1.36389 WP_001050913.1.36430 WP_001050913.1.36434 WP_001050913.1.36439 WP_001050913.1.36522 WP_001050913.1.36532 WP_001050913.1.36535 WP_001050913.1.3655 WP_001050913.1.36551 WP_001050913.1.36570 WP_001050913.1.36580 WP_001050913.1.36600 WP_001050913.1.36604 WP_001050913.1.36615 WP_001050913.1.36640 WP_001050913.1.36646 WP_001050913.1.3666 WP_001050913.1.36669 WP_001050913.1.36697 WP_001050913.1.36698 WP_001050913.1.36704 WP_001050913.1.36729 WP_001050913.1.36745 WP_001050913.1.3675 WP_001050913.1.36754 WP_001050913.1.36770 WP_001050913.1.36773 WP_001050913.1.36783 WP_001050913.1.36793 WP_001050913.1.36797 WP_001050913.1.36809 WP_001050913.1.36820 WP_001050913.1.36822 WP_001050913.1.36823 WP_001050913.1.36847 WP_001050913.1.3685 WP_001050913.1.36858 WP_001050913.1.3687 WP_001050913.1.36888 WP_001050913.1.3690 WP_001050913.1.36903 WP_001050913.1.36911 WP_001050913.1.36916 WP_001050913.1.36932 WP_001050913.1.36952 WP_001050913.1.36955 WP_001050913.1.36962 WP_001050913.1.36979 WP_001050913.1.36980 WP_001050913.1.36983 WP_001050913.1.36997 WP_001050913.1.37002 WP_001050913.1.37016 WP_001050913.1.3703 WP_001050913.1.37044 WP_001050913.1.37045 WP_001050913.1.37053 WP_001050913.1.37055 WP_001050913.1.37075 WP_001050913.1.37080 WP_001050913.1.3709 WP_001050913.1.37091 WP_001050913.1.37120 WP_001050913.1.37121 WP_001050913.1.37130 WP_001050913.1.37132 WP_001050913.1.37134 WP_001050913.1.37135 WP_001050913.1.37145 WP_001050913.1.37159 WP_001050913.1.3718 WP_001050913.1.3719 WP_001050913.1.3722 WP_001050913.1.37220 WP_001050913.1.37240 WP_001050913.1.37304 WP_001050913.1.37335 WP_001050913.1.37336 WP_001050913.1.37341 WP_001050913.1.37343 WP_001050913.1.37354 WP_001050913.1.37378 WP_001050913.1.37398 WP_001050913.1.37411 WP_001050913.1.37424 WP_001050913.1.37435 WP_001050913.1.37453 WP_001050913.1.37467 WP_001050913.1.37503 WP_001050913.1.37525 WP_001050913.1.37536 WP_001050913.1.37563 WP_001050913.1.37578 WP_001050913.1.37583 WP_001050913.1.37602 WP_001050913.1.37605 WP_001050913.1.37606 WP_001050913.1.37621 WP_001050913.1.37624 WP_001050913.1.37636 WP_001050913.1.37644 WP_001050913.1.37652 WP_001050913.1.37669 WP_001050913.1.37679 WP_001050913.1.3774 WP_001050913.1.37749 WP_001050913.1.3776 WP_001050913.1.37764 WP_001050913.1.37771 WP_001050913.1.37781 WP_001050913.1.37788 WP_001050913.1.37795 WP_001050913.1.37815 WP_001050913.1.37828 WP_001050913.1.3784 WP_001050913.1.37851 WP_001050913.1.37855 WP_001050913.1.37866 WP_001050913.1.37875 WP_001050913.1.37878 WP_001050913.1.37891 WP_001050913.1.37906 WP_001050913.1.37907 WP_001050913.1.37929 WP_001050913.1.37953 WP_001050913.1.37987 WP_001050913.1.38007 WP_001050913.1.38020 WP_001050913.1.38030 WP_001050913.1.38034 WP_001050913.1.38038 WP_001050913.1.38057 WP_001050913.1.38070 WP_001050913.1.38082 WP_001050913.1.3809 WP_001050913.1.38100 WP_001050913.1.38111 WP_001050913.1.38128 WP_001050913.1.3813 WP_001050913.1.38136 WP_001050913.1.38148 WP_001050913.1.38160 WP_001050913.1.3817 WP_001050913.1.38177 WP_001050913.1.3820 WP_001050913.1.38212 WP_001050913.1.38222 WP_001050913.1.38230 WP_001050913.1.38232 WP_001050913.1.3827 WP_001050913.1.38276 WP_001050913.1.38282 WP_001050913.1.38304 WP_001050913.1.38309 WP_001050913.1.38311 WP_001050913.1.38316 WP_001050913.1.38330 WP_001050913.1.38336 WP_001050913.1.38339 WP_001050913.1.38346 WP_001050913.1.38383 WP_001050913.1.3842 WP_001050913.1.38422 WP_001050913.1.38435 WP_001050913.1.38437 WP_001050913.1.38453 WP_001050913.1.38489 WP_001050913.1.38491 WP_001050913.1.38493 WP_001050913.1.38516 WP_001050913.1.3852 WP_001050913.1.38522 WP_001050913.1.38546 WP_001050913.1.38551 WP_001050913.1.38555 WP_001050913.1.38557 WP_001050913.1.38600 WP_001050913.1.38607 WP_001050913.1.38612 WP_001050913.1.38637 WP_001050913.1.38651 WP_001050913.1.38658 WP_001050913.1.38669 WP_001050913.1.3867 WP_001050913.1.38674 WP_001050913.1.38688 WP_001050913.1.38721 WP_001050913.1.3875 WP_001050913.1.38760 WP_001050913.1.38786 WP_001050913.1.38788 WP_001050913.1.38823 WP_001050913.1.38836 WP_001050913.1.38841 WP_001050913.1.38858 WP_001050913.1.38875 WP_001050913.1.38885 WP_001050913.1.38890 WP_001050913.1.38927 WP_001050913.1.38931 WP_001050913.1.3894 WP_001050913.1.38940 WP_001050913.1.38941 WP_001050913.1.38943 WP_001050913.1.38960 WP_001050913.1.38972 WP_001050913.1.38973 WP_001050913.1.38979 WP_001050913.1.38985 WP_001050913.1.390 WP_001050913.1.39012 WP_001050913.1.39014 WP_001050913.1.39017 WP_001050913.1.39020 WP_001050913.1.39026 WP_001050913.1.39043 WP_001050913.1.39053 WP_001050913.1.3906 WP_001050913.1.3908 WP_001050913.1.39080 WP_001050913.1.39089 WP_001050913.1.391 WP_001050913.1.39108 WP_001050913.1.39117 WP_001050913.1.39126 WP_001050913.1.39166 WP_001050913.1.39173 WP_001050913.1.39203 WP_001050913.1.39206 WP_001050913.1.39217 WP_001050913.1.39241 WP_001050913.1.3926 WP_001050913.1.39272 WP_001050913.1.39281 WP_001050913.1.39285 WP_001050913.1.39290 WP_001050913.1.39324 WP_001050913.1.39332 WP_001050913.1.39333 WP_001050913.1.39347 WP_001050913.1.39361 WP_001050913.1.39368 WP_001050913.1.39378 WP_001050913.1.39384 WP_001050913.1.39397 WP_001050913.1.39406 WP_001050913.1.39432 WP_001050913.1.39451 WP_001050913.1.39486 WP_001050913.1.39494 WP_001050913.1.39499 WP_001050913.1.39506 WP_001050913.1.39519 WP_001050913.1.39527 WP_001050913.1.39542 WP_001050913.1.39550 WP_001050913.1.39613 WP_001050913.1.39625 WP_001050913.1.39645 WP_001050913.1.39662 WP_001050913.1.39670 WP_001050913.1.39671 WP_001050913.1.39687 WP_001050913.1.39689 WP_001050913.1.39693 WP_001050913.1.39697 WP_001050913.1.39711 WP_001050913.1.39738 WP_001050913.1.39767 WP_001050913.1.39773 WP_001050913.1.39789 WP_001050913.1.39812 WP_001050913.1.39832 WP_001050913.1.39834 WP_001050913.1.39838 WP_001050913.1.39839 WP_001050913.1.39847 WP_001050913.1.39856 WP_001050913.1.39857 WP_001050913.1.39869 WP_001050913.1.39875 WP_001050913.1.39880 WP_001050913.1.39883 WP_001050913.1.39918 WP_001050913.1.39943 WP_001050913.1.39995 WP_001050913.1.40014 WP_001050913.1.40043 WP_001050913.1.40053 WP_001050913.1.4006 WP_001050913.1.40076 WP_001050913.1.40082 WP_001050913.1.40085 WP_001050913.1.40099 WP_001050913.1.4010 WP_001050913.1.40119 WP_001050913.1.4012 WP_001050913.1.40120 WP_001050913.1.40130 WP_001050913.1.40137 WP_001050913.1.40149 WP_001050913.1.4015 WP_001050913.1.40161 WP_001050913.1.40164 WP_001050913.1.40173 WP_001050913.1.4019 WP_001050913.1.40220 WP_001050913.1.40247 WP_001050913.1.4025 WP_001050913.1.40299 WP_001050913.1.40316 WP_001050913.1.40320 WP_001050913.1.40322 WP_001050913.1.40329 WP_001050913.1.40330 WP_001050913.1.40340 WP_001050913.1.40342 WP_001050913.1.40369 WP_001050913.1.40383 WP_001050913.1.40401 WP_001050913.1.40406 WP_001050913.1.40409 WP_001050913.1.40428 WP_001050913.1.40435 WP_001050913.1.40443 WP_001050913.1.4045 WP_001050913.1.40454 WP_001050913.1.40458 WP_001050913.1.40463 WP_001050913.1.40474 WP_001050913.1.40481 WP_001050913.1.40483 WP_001050913.1.40500 WP_001050913.1.40505 WP_001050913.1.40531 WP_001050913.1.40532 WP_001050913.1.40554 WP_001050913.1.4056 WP_001050913.1.4057 WP_001050913.1.40579 WP_001050913.1.40588 WP_001050913.1.40620 WP_001050913.1.40644 WP_001050913.1.40655 WP_001050913.1.40658 WP_001050913.1.40659 WP_001050913.1.40670 WP_001050913.1.40700 WP_001050913.1.40719 WP_001050913.1.40729 WP_001050913.1.40748 WP_001050913.1.40760 WP_001050913.1.4078 WP_001050913.1.40780 WP_001050913.1.40794 WP_001050913.1.40797 WP_001050913.1.40800 WP_001050913.1.40814 WP_001050913.1.40816 WP_001050913.1.40939 WP_001050913.1.40954 WP_001050913.1.40997 WP_001050913.1.41002 WP_001050913.1.41011 WP_001050913.1.4102 WP_001050913.1.41033 WP_001050913.1.41038 WP_001050913.1.4105 WP_001050913.1.41058 WP_001050913.1.41064 WP_001050913.1.41066 WP_001050913.1.41084 WP_001050913.1.41094 WP_001050913.1.41098 WP_001050913.1.41104 WP_001050913.1.41109 WP_001050913.1.41119 WP_001050913.1.41122 WP_001050913.1.41129 WP_001050913.1.41133 WP_001050913.1.4115 WP_001050913.1.41178 WP_001050913.1.412 WP_001050913.1.41208 WP_001050913.1.41238 WP_001050913.1.41241 WP_001050913.1.41245 WP_001050913.1.41255 WP_001050913.1.41288 WP_001050913.1.41289 WP_001050913.1.4129 WP_001050913.1.41314 WP_001050913.1.41341 WP_001050913.1.41350 WP_001050913.1.41374 WP_001050913.1.4138 WP_001050913.1.41386 WP_001050913.1.41389 WP_001050913.1.41411 WP_001050913.1.41426 WP_001050913.1.41432 WP_001050913.1.41433 WP_001050913.1.4144 WP_001050913.1.41444 WP_001050913.1.41448 WP_001050913.1.41456 WP_001050913.1.41458 WP_001050913.1.41461 WP_001050913.1.41473 WP_001050913.1.41499 WP_001050913.1.41511 WP_001050913.1.41532 WP_001050913.1.41533 WP_001050913.1.41555 WP_001050913.1.41558 WP_001050913.1.41567 WP_001050913.1.41581 WP_001050913.1.41582 WP_001050913.1.41587 WP_001050913.1.41597 WP_001050913.1.41598 WP_001050913.1.41599 WP_001050913.1.4160 WP_001050913.1.41612 WP_001050913.1.4162 WP_001050913.1.41620 WP_001050913.1.41623 WP_001050913.1.41647 WP_001050913.1.41674 WP_001050913.1.41681 WP_001050913.1.4169 WP_001050913.1.41698 WP_001050913.1.41726 WP_001050913.1.41743 WP_001050913.1.41755 WP_001050913.1.41770 WP_001050913.1.41796 WP_001050913.1.41817 WP_001050913.1.4182 WP_001050913.1.41821 WP_001050913.1.41839 WP_001050913.1.41863 WP_001050913.1.4188 WP_001050913.1.41891 WP_001050913.1.41898 WP_001050913.1.41906 WP_001050913.1.41935 WP_001050913.1.41943 WP_001050913.1.41954 WP_001050913.1.41972 WP_001050913.1.41983 WP_001050913.1.41989 WP_001050913.1.420 WP_001050913.1.42001 WP_001050913.1.42003 WP_001050913.1.42005 WP_001050913.1.42015 WP_001050913.1.42017 WP_001050913.1.42028 WP_001050913.1.42056 WP_001050913.1.42064 WP_001050913.1.42072 WP_001050913.1.42085 WP_001050913.1.42087 WP_001050913.1.42125 WP_001050913.1.42137 WP_001050913.1.42169 WP_001050913.1.42177 WP_001050913.1.42178 WP_001050913.1.42198 WP_001050913.1.42230 WP_001050913.1.42241 WP_001050913.1.4225 WP_001050913.1.42269 WP_001050913.1.42286 WP_001050913.1.42298 WP_001050913.1.42305 WP_001050913.1.4231 WP_001050913.1.42325 WP_001050913.1.42336 WP_001050913.1.42355 WP_001050913.1.42403 WP_001050913.1.42436 WP_001050913.1.42438 WP_001050913.1.42455 WP_001050913.1.42459 WP_001050913.1.42460 WP_001050913.1.42481 WP_001050913.1.42503 WP_001050913.1.42510 WP_001050913.1.42517 WP_001050913.1.42551 WP_001050913.1.42575 WP_001050913.1.42593 WP_001050913.1.42598 WP_001050913.1.426 WP_001050913.1.4260 WP_001050913.1.42607 WP_001050913.1.42640 WP_001050913.1.42652 WP_001050913.1.42667 WP_001050913.1.42668 WP_001050913.1.42674 WP_001050913.1.42679 WP_001050913.1.42681 WP_001050913.1.42706 WP_001050913.1.42733 WP_001050913.1.42737 WP_001050913.1.42738 WP_001050913.1.42740 WP_001050913.1.42759 WP_001050913.1.42764 WP_001050913.1.42786 WP_001050913.1.42798 WP_001050913.1.42802 WP_001050913.1.42816 WP_001050913.1.42819 WP_001050913.1.42837 WP_001050913.1.42848 WP_001050913.1.42883 WP_001050913.1.42893 WP_001050913.1.42897 WP_001050913.1.42907 WP_001050913.1.42924 WP_001050913.1.42925 WP_001050913.1.4293 WP_001050913.1.42959 WP_001050913.1.42984 WP_001050913.1.42985 WP_001050913.1.4299 WP_001050913.1.42990 WP_001050913.1.4300 WP_001050913.1.43014 WP_001050913.1.43020 WP_001050913.1.43023 WP_001050913.1.43033 WP_001050913.1.43047 WP_001050913.1.43061 WP_001050913.1.43072 WP_001050913.1.43095 WP_001050913.1.43110 WP_001050913.1.43114 WP_001050913.1.43122 WP_001050913.1.43125 WP_001050913.1.43131 WP_001050913.1.43134 WP_001050913.1.43139 WP_001050913.1.43143 WP_001050913.1.43159 WP_001050913.1.43165 WP_001050913.1.43168 WP_001050913.1.43179 WP_001050913.1.43200 WP_001050913.1.43202 WP_001050913.1.43206 WP_001050913.1.43220 WP_001050913.1.43225 WP_001050913.1.43232 WP_001050913.1.43248 WP_001050913.1.4325 WP_001050913.1.43252 WP_001050913.1.43263 WP_001050913.1.4327 WP_001050913.1.43274 WP_001050913.1.43279 WP_001050913.1.43323 WP_001050913.1.43325 WP_001050913.1.43328 WP_001050913.1.43331 WP_001050913.1.43341 WP_001050913.1.43349 WP_001050913.1.43360 WP_001050913.1.43366 WP_001050913.1.43369 WP_001050913.1.4337 WP_001050913.1.43375 WP_001050913.1.43383 WP_001050913.1.43405 WP_001050913.1.43406 WP_001050913.1.4341 WP_001050913.1.43410 WP_001050913.1.43414 WP_001050913.1.43446 WP_001050913.1.43460 WP_001050913.1.4347 WP_001050913.1.43506 WP_001050913.1.43512 WP_001050913.1.43550 WP_001050913.1.43560 WP_001050913.1.43573 WP_001050913.1.43594 WP_001050913.1.43600 WP_001050913.1.43617 WP_001050913.1.43618 WP_001050913.1.43627 WP_001050913.1.43659 WP_001050913.1.43665 WP_001050913.1.43670 WP_001050913.1.43683 WP_001050913.1.4369 WP_001050913.1.43693 WP_001050913.1.4370 WP_001050913.1.43702 WP_001050913.1.43703 WP_001050913.1.4372 WP_001050913.1.43731 WP_001050913.1.4374 WP_001050913.1.43752 WP_001050913.1.43784 WP_001050913.1.43788 WP_001050913.1.4379 WP_001050913.1.4380 WP_001050913.1.43800 WP_001050913.1.43819 WP_001050913.1.43822 WP_001050913.1.43827 WP_001050913.1.4385 WP_001050913.1.43851 WP_001050913.1.4386 WP_001050913.1.43915 WP_001050913.1.43924 WP_001050913.1.43964 WP_001050913.1.43984 WP_001050913.1.43988 WP_001050913.1.43995 WP_001050913.1.44021 WP_001050913.1.44072 WP_001050913.1.44074 WP_001050913.1.44095 WP_001050913.1.44119 WP_001050913.1.44150 WP_001050913.1.44153 WP_001050913.1.44177 WP_001050913.1.44181 WP_001050913.1.44186 WP_001050913.1.44195 WP_001050913.1.44255 WP_001050913.1.44265 WP_001050913.1.44331 WP_001050913.1.44344 WP_001050913.1.44382 WP_001050913.1.44388 WP_001050913.1.44396 WP_001050913.1.44405 WP_001050913.1.44420 WP_001050913.1.44432 WP_001050913.1.44455 WP_001050913.1.44480 WP_001050913.1.44493 WP_001050913.1.44504 WP_001050913.1.44515 WP_001050913.1.44517 WP_001050913.1.44520 WP_001050913.1.44536 WP_001050913.1.44544 WP_001050913.1.44547 WP_001050913.1.44579 WP_001050913.1.44586 WP_001050913.1.44588 WP_001050913.1.44605 WP_001050913.1.44623 WP_001050913.1.44631 WP_001050913.1.44646 WP_001050913.1.44667 WP_001050913.1.44672 WP_001050913.1.44674 WP_001050913.1.447 WP_001050913.1.44714 WP_001050913.1.44715 WP_001050913.1.44732 WP_001050913.1.44755 WP_001050913.1.44768 WP_001050913.1.44780 WP_001050913.1.44785 WP_001050913.1.44788 WP_001050913.1.44796 WP_001050913.1.44802 WP_001050913.1.44853 WP_001050913.1.44856 WP_001050913.1.44868 WP_001050913.1.44881 WP_001050913.1.44882 WP_001050913.1.44891 WP_001050913.1.44892 WP_001050913.1.44903 WP_001050913.1.44914 WP_001050913.1.44932 WP_001050913.1.44948 WP_001050913.1.44955 WP_001050913.1.44969 WP_001050913.1.4499 WP_001050913.1.44993 WP_001050913.1.45008 WP_001050913.1.45010 WP_001050913.1.45015 WP_001050913.1.45033 WP_001050913.1.45042 WP_001050913.1.45050 WP_001050913.1.45080 WP_001050913.1.45091 WP_001050913.1.45094 WP_001050913.1.45099 WP_001050913.1.45101 WP_001050913.1.45111 WP_001050913.1.45114 WP_001050913.1.4513 WP_001050913.1.45131 WP_001050913.1.45132 WP_001050913.1.45133 WP_001050913.1.45140 WP_001050913.1.45157 WP_001050913.1.45162 WP_001050913.1.45170 WP_001050913.1.45188 WP_001050913.1.45189 WP_001050913.1.452 WP_001050913.1.45218 WP_001050913.1.45221 WP_001050913.1.45223 WP_001050913.1.45242 WP_001050913.1.45267 WP_001050913.1.4527 WP_001050913.1.45272 WP_001050913.1.45281 WP_001050913.1.45290 WP_001050913.1.45297 WP_001050913.1.453 WP_001050913.1.45303 WP_001050913.1.45321 WP_001050913.1.45332 WP_001050913.1.45364 WP_001050913.1.45419 WP_001050913.1.45431 WP_001050913.1.45439 WP_001050913.1.45447 WP_001050913.1.45450 WP_001050913.1.45456 WP_001050913.1.4546 WP_001050913.1.45472 WP_001050913.1.45492 WP_001050913.1.4550 WP_001050913.1.45507 WP_001050913.1.45542 WP_001050913.1.45555 WP_001050913.1.45560 WP_001050913.1.45574 WP_001050913.1.45577 WP_001050913.1.45586 WP_001050913.1.45610 WP_001050913.1.45620 WP_001050913.1.45640 WP_001050913.1.45645 WP_001050913.1.45654 WP_001050913.1.45670 WP_001050913.1.45698 WP_001050913.1.45703 WP_001050913.1.45705 WP_001050913.1.45713 WP_001050913.1.45730 WP_001050913.1.45734 WP_001050913.1.45747 WP_001050913.1.45763 WP_001050913.1.45768 WP_001050913.1.4577 WP_001050913.1.45771 WP_001050913.1.45780 WP_001050913.1.4580 WP_001050913.1.45822 WP_001050913.1.45833 WP_001050913.1.4584 WP_001050913.1.45852 WP_001050913.1.45859 WP_001050913.1.45862 WP_001050913.1.45870 WP_001050913.1.45874 WP_001050913.1.45875 WP_001050913.1.45878 WP_001050913.1.45888 WP_001050913.1.45897 WP_001050913.1.459 WP_001050913.1.45954 WP_001050913.1.4597 WP_001050913.1.45977 WP_001050913.1.45979 WP_001050913.1.4598 WP_001050913.1.46003 WP_001050913.1.46005 WP_001050913.1.46013 WP_001050913.1.46021 WP_001050913.1.46035 WP_001050913.1.46037 WP_001050913.1.46050 WP_001050913.1.46055 WP_001050913.1.46062 WP_001050913.1.46071 WP_001050913.1.46078 WP_001050913.1.46082 WP_001050913.1.46087 WP_001050913.1.46106 WP_001050913.1.46109 WP_001050913.1.46136 WP_001050913.1.46168 WP_001050913.1.46171 WP_001050913.1.46172 WP_001050913.1.46195 WP_001050913.1.46208 WP_001050913.1.46212 WP_001050913.1.46222 WP_001050913.1.46228 WP_001050913.1.46248 WP_001050913.1.46259 WP_001050913.1.46276 WP_001050913.1.46289 WP_001050913.1.46320 WP_001050913.1.46330 WP_001050913.1.46333 WP_001050913.1.46334 WP_001050913.1.46339 WP_001050913.1.46353 WP_001050913.1.46362 WP_001050913.1.46368 WP_001050913.1.46380 WP_001050913.1.46389 WP_001050913.1.46401 WP_001050913.1.46418 WP_001050913.1.46422 WP_001050913.1.46457 WP_001050913.1.46465 WP_001050913.1.46488 WP_001050913.1.46514 WP_001050913.1.46528 WP_001050913.1.46529 WP_001050913.1.46534 WP_001050913.1.46543 WP_001050913.1.46576 WP_001050913.1.46587 WP_001050913.1.46608 WP_001050913.1.46619 WP_001050913.1.4662 WP_001050913.1.46648 WP_001050913.1.46660 WP_001050913.1.46670 WP_001050913.1.46676 WP_001050913.1.46688 WP_001050913.1.46692 WP_001050913.1.46696 WP_001050913.1.46702 WP_001050913.1.46703 WP_001050913.1.46720 WP_001050913.1.46736 WP_001050913.1.46752 WP_001050913.1.46765 WP_001050913.1.46767 WP_001050913.1.46770 WP_001050913.1.46772 WP_001050913.1.4680 WP_001050913.1.46815 WP_001050913.1.46823 WP_001050913.1.46837 WP_001050913.1.46852 WP_001050913.1.46875 WP_001050913.1.46881 WP_001050913.1.46906 WP_001050913.1.46908 WP_001050913.1.46911 WP_001050913.1.46914 WP_001050913.1.46925 WP_001050913.1.46929 WP_001050913.1.4694 WP_001050913.1.46947 WP_001050913.1.4696 WP_001050913.1.46964 WP_001050913.1.46965 WP_001050913.1.46983 WP_001050913.1.46995 WP_001050913.1.47002 WP_001050913.1.47051 WP_001050913.1.47065 WP_001050913.1.47090 WP_001050913.1.47105 WP_001050913.1.47107 WP_001050913.1.47111 WP_001050913.1.47128 WP_001050913.1.47153 WP_001050913.1.47159 WP_001050913.1.4716 WP_001050913.1.47163 WP_001050913.1.47175 WP_001050913.1.47187 WP_001050913.1.47193 WP_001050913.1.47205 WP_001050913.1.47211 WP_001050913.1.47216 WP_001050913.1.47218 WP_001050913.1.47250 WP_001050913.1.47258 WP_001050913.1.47269 WP_001050913.1.47276 WP_001050913.1.47279 WP_001050913.1.4728 WP_001050913.1.47282 WP_001050913.1.47290 WP_001050913.1.47294 WP_001050913.1.47306 WP_001050913.1.47308 WP_001050913.1.47317 WP_001050913.1.47328 WP_001050913.1.47331 WP_001050913.1.47334 WP_001050913.1.47353 WP_001050913.1.47381 WP_001050913.1.47383 WP_001050913.1.47399 WP_001050913.1.47405 WP_001050913.1.47406 WP_001050913.1.47408 WP_001050913.1.47422 WP_001050913.1.47426 WP_001050913.1.47432 WP_001050913.1.47439 WP_001050913.1.47450 WP_001050913.1.47459 WP_001050913.1.47493 WP_001050913.1.4752 WP_001050913.1.47522 WP_001050913.1.47530 WP_001050913.1.47541 WP_001050913.1.47560 WP_001050913.1.47561 WP_001050913.1.47570 WP_001050913.1.47577 WP_001050913.1.47617 WP_001050913.1.47618 WP_001050913.1.47629 WP_001050913.1.47667 WP_001050913.1.47669 WP_001050913.1.4767 WP_001050913.1.47680 WP_001050913.1.477 WP_001050913.1.47702 WP_001050913.1.47719 WP_001050913.1.47733 WP_001050913.1.47747 WP_001050913.1.47763 WP_001050913.1.47782 WP_001050913.1.47792 WP_001050913.1.47821 WP_001050913.1.47835 WP_001050913.1.47836 WP_001050913.1.47859 WP_001050913.1.47864 WP_001050913.1.47872 WP_001050913.1.47873 WP_001050913.1.47888 WP_001050913.1.47901 WP_001050913.1.47904 WP_001050913.1.47908 WP_001050913.1.4792 WP_001050913.1.47951 WP_001050913.1.47980 WP_001050913.1.47989 WP_001050913.1.47996 WP_001050913.1.48009 WP_001050913.1.48011 WP_001050913.1.48013 WP_001050913.1.48017 WP_001050913.1.48030 WP_001050913.1.48046 WP_001050913.1.48047 WP_001050913.1.4805 WP_001050913.1.48057 WP_001050913.1.48067 WP_001050913.1.48116 WP_001050913.1.48142 WP_001050913.1.4815 WP_001050913.1.48154 WP_001050913.1.48156 WP_001050913.1.48169 WP_001050913.1.48186 WP_001050913.1.48187 WP_001050913.1.48197 WP_001050913.1.48199 WP_001050913.1.48205 WP_001050913.1.48212 WP_001050913.1.48223 WP_001050913.1.48236 WP_001050913.1.48250 WP_001050913.1.48272 WP_001050913.1.48282 WP_001050913.1.48284 WP_001050913.1.48293 WP_001050913.1.48307 WP_001050913.1.48310 WP_001050913.1.48322 WP_001050913.1.48326 WP_001050913.1.48335 WP_001050913.1.48364 WP_001050913.1.48376 WP_001050913.1.48391 WP_001050913.1.48394 WP_001050913.1.48398 WP_001050913.1.484 WP_001050913.1.4840 WP_001050913.1.48425 WP_001050913.1.48427 WP_001050913.1.48437 WP_001050913.1.48438 WP_001050913.1.48463 WP_001050913.1.48479 WP_001050913.1.48492 WP_001050913.1.4852 WP_001050913.1.48556 WP_001050913.1.48563 WP_001050913.1.48577 WP_001050913.1.48580 WP_001050913.1.48593 WP_001050913.1.48601 WP_001050913.1.48634 WP_001050913.1.48655 WP_001050913.1.48656 WP_001050913.1.48670 WP_001050913.1.4868 WP_001050913.1.48694 WP_001050913.1.48705 WP_001050913.1.48711 WP_001050913.1.48723 WP_001050913.1.48769 WP_001050913.1.48775 WP_001050913.1.48782 WP_001050913.1.48786 WP_001050913.1.48805 WP_001050913.1.48817 WP_001050913.1.48818 WP_001050913.1.48823 WP_001050913.1.48833 WP_001050913.1.48835 WP_001050913.1.4886 WP_001050913.1.48869 WP_001050913.1.48936 WP_001050913.1.48941 WP_001050913.1.48943 WP_001050913.1.48945 WP_001050913.1.48951 WP_001050913.1.48966 WP_001050913.1.48968 WP_001050913.1.48982 WP_001050913.1.48993 WP_001050913.1.4901 WP_001050913.1.49018 WP_001050913.1.49032 WP_001050913.1.4905 WP_001050913.1.49071 WP_001050913.1.49094 WP_001050913.1.49105 WP_001050913.1.49128 WP_001050913.1.49129 WP_001050913.1.49143 WP_001050913.1.49150 WP_001050913.1.49152 WP_001050913.1.49154 WP_001050913.1.49159 WP_001050913.1.49161 WP_001050913.1.4917 WP_001050913.1.49171 WP_001050913.1.49173 WP_001050913.1.4918 WP_001050913.1.49189 WP_001050913.1.49196 WP_001050913.1.49199 WP_001050913.1.4920 WP_001050913.1.49207 WP_001050913.1.4921 WP_001050913.1.49227 WP_001050913.1.49234 WP_001050913.1.49248 WP_001050913.1.49257 WP_001050913.1.49301 WP_001050913.1.49326 WP_001050913.1.49327 WP_001050913.1.49330 WP_001050913.1.49373 WP_001050913.1.49398 WP_001050913.1.49418 WP_001050913.1.49444 WP_001050913.1.4945 WP_001050913.1.49479 WP_001050913.1.49484 WP_001050913.1.4950 WP_001050913.1.49518 WP_001050913.1.49530 WP_001050913.1.49539 WP_001050913.1.49549 WP_001050913.1.49573 WP_001050913.1.49581 WP_001050913.1.49582 WP_001050913.1.496 WP_001050913.1.49603 WP_001050913.1.49605 WP_001050913.1.4962 WP_001050913.1.49643 WP_001050913.1.49653 WP_001050913.1.49658 WP_001050913.1.49669 WP_001050913.1.49671 WP_001050913.1.49672 WP_001050913.1.49690 WP_001050913.1.49704 WP_001050913.1.49707 WP_001050913.1.49715 WP_001050913.1.49728 WP_001050913.1.49730 WP_001050913.1.49732 WP_001050913.1.49742 WP_001050913.1.49745 WP_001050913.1.49757 WP_001050913.1.4980 WP_001050913.1.49800 WP_001050913.1.49819 WP_001050913.1.4982 WP_001050913.1.49825 WP_001050913.1.4984 WP_001050913.1.49863 WP_001050913.1.4987 WP_001050913.1.49871 WP_001050913.1.4989 WP_001050913.1.49894 WP_001050913.1.49907 WP_001050913.1.49912 WP_001050913.1.49913 WP_001050913.1.49917 WP_001050913.1.49918 WP_001050913.1.49921 WP_001050913.1.49934 WP_001050913.1.49935 WP_001050913.1.49936 WP_001050913.1.4994 WP_001050913.1.49943 WP_001050913.1.49951 WP_001050913.1.49970 WP_001050913.1.49982 WP_001050913.1.50013 WP_001050913.1.50015 WP_001050913.1.50023 WP_001050913.1.50028 WP_001050913.1.50039 WP_001050913.1.50061 WP_001050913.1.50064 WP_001050913.1.50071 WP_001050913.1.50076 WP_001050913.1.50117 WP_001050913.1.5013 WP_001050913.1.50138 WP_001050913.1.50145 WP_001050913.1.50175 WP_001050913.1.50192 WP_001050913.1.50212 WP_001050913.1.50219 WP_001050913.1.50229 WP_001050913.1.50261 WP_001050913.1.50291 WP_001050913.1.50313 WP_001050913.1.50314 WP_001050913.1.5035 WP_001050913.1.50356 WP_001050913.1.50360 WP_001050913.1.50367 WP_001050913.1.50369 WP_001050913.1.50377 WP_001050913.1.50388 WP_001050913.1.50424 WP_001050913.1.50425 WP_001050913.1.50430 WP_001050913.1.50431 WP_001050913.1.50440 WP_001050913.1.50464 WP_001050913.1.50477 WP_001050913.1.50516 WP_001050913.1.50525 WP_001050913.1.50527 WP_001050913.1.50536 WP_001050913.1.50543 WP_001050913.1.50555 WP_001050913.1.50556 WP_001050913.1.50558 WP_001050913.1.50568 WP_001050913.1.50578 WP_001050913.1.5059 WP_001050913.1.50594 WP_001050913.1.50595 WP_001050913.1.50647 WP_001050913.1.50660 WP_001050913.1.50669 WP_001050913.1.50699 WP_001050913.1.50732 WP_001050913.1.50740 WP_001050913.1.50742 WP_001050913.1.50745 WP_001050913.1.50748 WP_001050913.1.50759 WP_001050913.1.50768 WP_001050913.1.50799 WP_001050913.1.5080 WP_001050913.1.50817 WP_001050913.1.50820 WP_001050913.1.50827 WP_001050913.1.50829 WP_001050913.1.5087 WP_001050913.1.50884 WP_001050913.1.50896 WP_001050913.1.50937 WP_001050913.1.50958 WP_001050913.1.50962 WP_001050913.1.50974 WP_001050913.1.51008 WP_001050913.1.51015 WP_001050913.1.51031 WP_001050913.1.51062 WP_001050913.1.5108 WP_001050913.1.51085 WP_001050913.1.5109 WP_001050913.1.5110 WP_001050913.1.5111 WP_001050913.1.51130 WP_001050913.1.51138 WP_001050913.1.51152 WP_001050913.1.5117 WP_001050913.1.51194 WP_001050913.1.51209 WP_001050913.1.51220 WP_001050913.1.51226 WP_001050913.1.51236 WP_001050913.1.51245 WP_001050913.1.51250 WP_001050913.1.51277 WP_001050913.1.51282 WP_001050913.1.51295 WP_001050913.1.51306 WP_001050913.1.51310 WP_001050913.1.51326 WP_001050913.1.51346 WP_001050913.1.51365 WP_001050913.1.51376 WP_001050913.1.51377 WP_001050913.1.51393 WP_001050913.1.51403 WP_001050913.1.51418 WP_001050913.1.5145 WP_001050913.1.51454 WP_001050913.1.51456 WP_001050913.1.51465 WP_001050913.1.51469 WP_001050913.1.51496 WP_001050913.1.515 WP_001050913.1.51527 WP_001050913.1.5155 WP_001050913.1.51557 WP_001050913.1.51558 WP_001050913.1.51559 WP_001050913.1.51571 WP_001050913.1.51575 WP_001050913.1.51590 WP_001050913.1.51619 WP_001050913.1.51623 WP_001050913.1.51657 WP_001050913.1.51665 WP_001050913.1.51672 WP_001050913.1.51702 WP_001050913.1.51713 WP_001050913.1.51716 WP_001050913.1.51744 WP_001050913.1.51748 WP_001050913.1.51751 WP_001050913.1.51787 WP_001050913.1.51794 WP_001050913.1.51812 WP_001050913.1.51824 WP_001050913.1.51836 WP_001050913.1.51842 WP_001050913.1.51844 WP_001050913.1.5186 WP_001050913.1.51866 WP_001050913.1.51871 WP_001050913.1.51883 WP_001050913.1.5190 WP_001050913.1.51912 WP_001050913.1.51920 WP_001050913.1.51924 WP_001050913.1.51936 WP_001050913.1.51952 WP_001050913.1.51971 WP_001050913.1.51973 WP_001050913.1.51995 WP_001050913.1.52034 WP_001050913.1.52061 WP_001050913.1.52072 WP_001050913.1.52078 WP_001050913.1.5209 WP_001050913.1.521 WP_001050913.1.5213 WP_001050913.1.52151 WP_001050913.1.52162 WP_001050913.1.52182 WP_001050913.1.52185 WP_001050913.1.52193 WP_001050913.1.52195 WP_001050913.1.52198 WP_001050913.1.52210 WP_001050913.1.52224 WP_001050913.1.52251 WP_001050913.1.52252 WP_001050913.1.52259 WP_001050913.1.5228 WP_001050913.1.52289 WP_001050913.1.52296 WP_001050913.1.523 WP_001050913.1.52308 WP_001050913.1.5231 WP_001050913.1.52322 WP_001050913.1.52327 WP_001050913.1.52331 WP_001050913.1.52340 WP_001050913.1.52343 WP_001050913.1.52377 WP_001050913.1.52396 WP_001050913.1.52423 WP_001050913.1.52427 WP_001050913.1.52436 WP_001050913.1.52442 WP_001050913.1.52452 WP_001050913.1.52463 WP_001050913.1.52464 WP_001050913.1.52474 WP_001050913.1.5251 WP_001050913.1.52518 WP_001050913.1.52536 WP_001050913.1.52548 WP_001050913.1.52595 WP_001050913.1.52602 WP_001050913.1.52605 WP_001050913.1.52622 WP_001050913.1.52623 WP_001050913.1.52624 WP_001050913.1.52633 WP_001050913.1.52660 WP_001050913.1.52670 WP_001050913.1.52687 WP_001050913.1.52699 WP_001050913.1.52715 WP_001050913.1.52722 WP_001050913.1.52751 WP_001050913.1.52754 WP_001050913.1.52772 WP_001050913.1.52820 WP_001050913.1.52828 WP_001050913.1.52830 WP_001050913.1.52836 WP_001050913.1.52838 WP_001050913.1.52848 WP_001050913.1.52865 WP_001050913.1.52877 WP_001050913.1.52878 WP_001050913.1.52886 WP_001050913.1.52889 WP_001050913.1.52900 WP_001050913.1.52904 WP_001050913.1.52941 WP_001050913.1.52947 WP_001050913.1.52965 WP_001050913.1.52983 WP_001050913.1.52984 WP_001050913.1.52992 WP_001050913.1.53002 WP_001050913.1.53007 WP_001050913.1.53022 WP_001050913.1.5304 WP_001050913.1.53050 WP_001050913.1.53057 WP_001050913.1.53060 WP_001050913.1.53069 WP_001050913.1.53071 WP_001050913.1.53077 WP_001050913.1.53109 WP_001050913.1.53153 WP_001050913.1.53178 WP_001050913.1.53189 WP_001050913.1.5319 WP_001050913.1.53209 WP_001050913.1.5321 WP_001050913.1.5323 WP_001050913.1.53245 WP_001050913.1.53260 WP_001050913.1.53285 WP_001050913.1.53312 WP_001050913.1.53317 WP_001050913.1.53319 WP_001050913.1.53323 WP_001050913.1.53352 WP_001050913.1.5336 WP_001050913.1.53363 WP_001050913.1.53366 WP_001050913.1.53372 WP_001050913.1.53373 WP_001050913.1.53379 WP_001050913.1.53383 WP_001050913.1.53387 WP_001050913.1.53394 WP_001050913.1.53403 WP_001050913.1.53408 WP_001050913.1.53418 WP_001050913.1.53433 WP_001050913.1.53444 WP_001050913.1.53452 WP_001050913.1.53462 WP_001050913.1.53467 WP_001050913.1.53488 WP_001050913.1.53503 WP_001050913.1.53521 WP_001050913.1.53577 WP_001050913.1.53641 WP_001050913.1.53648 WP_001050913.1.53661 WP_001050913.1.53671 WP_001050913.1.53682 WP_001050913.1.53691 WP_001050913.1.53712 WP_001050913.1.53714 WP_001050913.1.53758 WP_001050913.1.53759 WP_001050913.1.53763 WP_001050913.1.53766 WP_001050913.1.53774 WP_001050913.1.53786 WP_001050913.1.53799 WP_001050913.1.5382 WP_001050913.1.53835 WP_001050913.1.53886 WP_001050913.1.53889 WP_001050913.1.53915 WP_001050913.1.53924 WP_001050913.1.53926 WP_001050913.1.53934 WP_001050913.1.53969 WP_001050913.1.53999 WP_001050913.1.5401 WP_001050913.1.54022 WP_001050913.1.54029 WP_001050913.1.54048 WP_001050913.1.54049 WP_001050913.1.54074 WP_001050913.1.54086 WP_001050913.1.54094 WP_001050913.1.54105 WP_001050913.1.54109 WP_001050913.1.54135 WP_001050913.1.54147 WP_001050913.1.54161 WP_001050913.1.54199 WP_001050913.1.54229 WP_001050913.1.54237 WP_001050913.1.54246 WP_001050913.1.54253 WP_001050913.1.54269 WP_001050913.1.54282 WP_001050913.1.54297 WP_001050913.1.54299 WP_001050913.1.54332 WP_001050913.1.54373 WP_001050913.1.54395 WP_001050913.1.544 WP_001050913.1.54404 WP_001050913.1.54413 WP_001050913.1.54426 WP_001050913.1.54438 WP_001050913.1.54446 WP_001050913.1.54471 WP_001050913.1.54477 WP_001050913.1.54479 WP_001050913.1.54485 WP_001050913.1.54491 WP_001050913.1.54503 WP_001050913.1.54510 WP_001050913.1.54518 WP_001050913.1.54539 WP_001050913.1.54543 WP_001050913.1.54551 WP_001050913.1.54554 WP_001050913.1.54572 WP_001050913.1.54574 WP_001050913.1.54637 WP_001050913.1.54689 WP_001050913.1.5469 WP_001050913.1.54728 WP_001050913.1.54733 WP_001050913.1.54744 WP_001050913.1.54745 WP_001050913.1.54753 WP_001050913.1.54819 WP_001050913.1.54826 WP_001050913.1.54847 WP_001050913.1.54895 WP_001050913.1.54914 WP_001050913.1.54931 WP_001050913.1.54955 WP_001050913.1.54967 WP_001050913.1.54990 WP_001050913.1.54995 WP_001050913.1.5500 WP_001050913.1.55004 WP_001050913.1.55014 WP_001050913.1.55058 WP_001050913.1.55082 WP_001050913.1.55084 WP_001050913.1.55090 WP_001050913.1.55095 WP_001050913.1.55100 WP_001050913.1.55139 WP_001050913.1.5518 WP_001050913.1.5519 WP_001050913.1.552 WP_001050913.1.55214 WP_001050913.1.55220 WP_001050913.1.55239 WP_001050913.1.55271 WP_001050913.1.55272 WP_001050913.1.55274 WP_001050913.1.55301 WP_001050913.1.55306 WP_001050913.1.55309 WP_001050913.1.55327 WP_001050913.1.55336 WP_001050913.1.55352 WP_001050913.1.55353 WP_001050913.1.55367 WP_001050913.1.55369 WP_001050913.1.55403 WP_001050913.1.55405 WP_001050913.1.55419 WP_001050913.1.55421 WP_001050913.1.55442 WP_001050913.1.55495 WP_001050913.1.5550 WP_001050913.1.55508 WP_001050913.1.55527 WP_001050913.1.55535 WP_001050913.1.55538 WP_001050913.1.5554 WP_001050913.1.55544 WP_001050913.1.55558 WP_001050913.1.5556 WP_001050913.1.55573 WP_001050913.1.55583 WP_001050913.1.5559 WP_001050913.1.55603 WP_001050913.1.5562 WP_001050913.1.55620 WP_001050913.1.55628 WP_001050913.1.5565 WP_001050913.1.55653 WP_001050913.1.55657 WP_001050913.1.557 WP_001050913.1.55717 WP_001050913.1.55719 WP_001050913.1.55724 WP_001050913.1.55728 WP_001050913.1.55746 WP_001050913.1.5575 WP_001050913.1.55784 WP_001050913.1.55786 WP_001050913.1.5580 WP_001050913.1.55818 WP_001050913.1.55831 WP_001050913.1.55835 WP_001050913.1.55839 WP_001050913.1.55845 WP_001050913.1.55848 WP_001050913.1.55854 WP_001050913.1.55859 WP_001050913.1.55867 WP_001050913.1.55874 WP_001050913.1.55886 WP_001050913.1.5589 WP_001050913.1.5590 WP_001050913.1.55904 WP_001050913.1.55916 WP_001050913.1.55933 WP_001050913.1.55949 WP_001050913.1.55953 WP_001050913.1.55955 WP_001050913.1.55960 WP_001050913.1.55985 WP_001050913.1.55991 WP_001050913.1.56000 WP_001050913.1.56003 WP_001050913.1.56025 WP_001050913.1.56039 WP_001050913.1.5604 WP_001050913.1.56048 WP_001050913.1.5606 WP_001050913.1.56064 WP_001050913.1.56078 WP_001050913.1.56098 WP_001050913.1.56099 WP_001050913.1.56106 WP_001050913.1.56135 WP_001050913.1.56153 WP_001050913.1.56200 WP_001050913.1.56210 WP_001050913.1.56213 WP_001050913.1.56214 WP_001050913.1.56220 WP_001050913.1.56225 WP_001050913.1.5623 WP_001050913.1.56237 WP_001050913.1.56239 WP_001050913.1.56241 WP_001050913.1.56272 WP_001050913.1.56275 WP_001050913.1.56281 WP_001050913.1.56306 WP_001050913.1.56332 WP_001050913.1.56333 WP_001050913.1.56343 WP_001050913.1.5635 WP_001050913.1.56364 WP_001050913.1.5637 WP_001050913.1.56377 WP_001050913.1.56387 WP_001050913.1.56400 WP_001050913.1.5644 WP_001050913.1.56444 WP_001050913.1.56453 WP_001050913.1.56464 WP_001050913.1.56482 WP_001050913.1.56496 WP_001050913.1.56522 WP_001050913.1.56525 WP_001050913.1.56527 WP_001050913.1.56530 WP_001050913.1.56542 WP_001050913.1.56558 WP_001050913.1.56570 WP_001050913.1.5658 WP_001050913.1.56584 WP_001050913.1.56598 WP_001050913.1.566 WP_001050913.1.56608 WP_001050913.1.56619 WP_001050913.1.56628 WP_001050913.1.56641 WP_001050913.1.5665 WP_001050913.1.56658 WP_001050913.1.5666 WP_001050913.1.56679 WP_001050913.1.56696 WP_001050913.1.56702 WP_001050913.1.56708 WP_001050913.1.56722 WP_001050913.1.56723 WP_001050913.1.5675 WP_001050913.1.56767 WP_001050913.1.5677 WP_001050913.1.56772 WP_001050913.1.56778 WP_001050913.1.56794 WP_001050913.1.56803 WP_001050913.1.56806 WP_001050913.1.56815 WP_001050913.1.56822 WP_001050913.1.56856 WP_001050913.1.5686 WP_001050913.1.56865 WP_001050913.1.56878 WP_001050913.1.569 WP_001050913.1.56903 WP_001050913.1.56931 WP_001050913.1.56966 WP_001050913.1.56967 WP_001050913.1.56975 WP_001050913.1.56986 WP_001050913.1.57015 WP_001050913.1.57047 WP_001050913.1.5705 WP_001050913.1.57073 WP_001050913.1.57075 WP_001050913.1.57080 WP_001050913.1.57081 WP_001050913.1.57097 WP_001050913.1.57109 WP_001050913.1.57115 WP_001050913.1.57141 WP_001050913.1.57158 WP_001050913.1.57170 WP_001050913.1.57175 WP_001050913.1.5718 WP_001050913.1.57190 WP_001050913.1.57196 WP_001050913.1.57214 WP_001050913.1.57223 WP_001050913.1.57265 WP_001050913.1.57271 WP_001050913.1.57291 WP_001050913.1.57309 WP_001050913.1.57316 WP_001050913.1.57330 WP_001050913.1.57338 WP_001050913.1.5735 WP_001050913.1.57376 WP_001050913.1.57385 WP_001050913.1.57389 WP_001050913.1.57427 WP_001050913.1.5743 WP_001050913.1.57445 WP_001050913.1.57459 WP_001050913.1.5749 WP_001050913.1.57507 WP_001050913.1.5752 WP_001050913.1.57577 WP_001050913.1.57593 WP_001050913.1.57594 WP_001050913.1.57612 WP_001050913.1.57614 WP_001050913.1.5763 WP_001050913.1.57635 WP_001050913.1.57650 WP_001050913.1.57665 WP_001050913.1.57670 WP_001050913.1.57682 WP_001050913.1.57692 WP_001050913.1.57693 WP_001050913.1.5770 WP_001050913.1.57701 WP_001050913.1.57718 WP_001050913.1.57720 WP_001050913.1.57723 WP_001050913.1.57727 WP_001050913.1.57730 WP_001050913.1.57734 WP_001050913.1.57745 WP_001050913.1.57754 WP_001050913.1.57761 WP_001050913.1.57770 WP_001050913.1.57783 WP_001050913.1.57808 WP_001050913.1.57819 WP_001050913.1.57837 WP_001050913.1.57840 WP_001050913.1.57844 WP_001050913.1.57875 WP_001050913.1.57878 WP_001050913.1.57883 WP_001050913.1.57888 WP_001050913.1.579 WP_001050913.1.5791 WP_001050913.1.57910 WP_001050913.1.57915 WP_001050913.1.57928 WP_001050913.1.57943 WP_001050913.1.57944 WP_001050913.1.57952 WP_001050913.1.57962 WP_001050913.1.57974 WP_001050913.1.5799 WP_001050913.1.58005 WP_001050913.1.58006 WP_001050913.1.58014 WP_001050913.1.58016 WP_001050913.1.58017 WP_001050913.1.58035 WP_001050913.1.58042 WP_001050913.1.58049 WP_001050913.1.58050 WP_001050913.1.58051 WP_001050913.1.58074 WP_001050913.1.58106 WP_001050913.1.58116 WP_001050913.1.58122 WP_001050913.1.58127 WP_001050913.1.58139 WP_001050913.1.58148 WP_001050913.1.58158 WP_001050913.1.5816 WP_001050913.1.5817 WP_001050913.1.58175 WP_001050913.1.58198 WP_001050913.1.58212 WP_001050913.1.58241 WP_001050913.1.58242 WP_001050913.1.58246 WP_001050913.1.5827 WP_001050913.1.58277 WP_001050913.1.58317 WP_001050913.1.5832 WP_001050913.1.58321 WP_001050913.1.58325 WP_001050913.1.58350 WP_001050913.1.58352 WP_001050913.1.58353 WP_001050913.1.58364 WP_001050913.1.58366 WP_001050913.1.58373 WP_001050913.1.58388 WP_001050913.1.58392 WP_001050913.1.58395 WP_001050913.1.58413 WP_001050913.1.58419 WP_001050913.1.58421 WP_001050913.1.58430 WP_001050913.1.58435 WP_001050913.1.58473 WP_001050913.1.5849 WP_001050913.1.58495 WP_001050913.1.58497 WP_001050913.1.58504 WP_001050913.1.58508 WP_001050913.1.58512 WP_001050913.1.58521 WP_001050913.1.58530 WP_001050913.1.58538 WP_001050913.1.58549 WP_001050913.1.5857 WP_001050913.1.58571 WP_001050913.1.58584 WP_001050913.1.58588 WP_001050913.1.58592 WP_001050913.1.58598 WP_001050913.1.586 WP_001050913.1.58626 WP_001050913.1.58686 WP_001050913.1.58701 WP_001050913.1.58704 WP_001050913.1.58714 WP_001050913.1.58718 WP_001050913.1.58735 WP_001050913.1.58760 WP_001050913.1.58763 WP_001050913.1.58772 WP_001050913.1.58775 WP_001050913.1.58798 WP_001050913.1.5880 WP_001050913.1.58839 WP_001050913.1.58855 WP_001050913.1.58860 WP_001050913.1.58934 WP_001050913.1.58936 WP_001050913.1.58960 WP_001050913.1.58981 WP_001050913.1.58991 WP_001050913.1.58998 WP_001050913.1.5901 WP_001050913.1.59011 WP_001050913.1.59014 WP_001050913.1.59039 WP_001050913.1.59046 WP_001050913.1.59062 WP_001050913.1.59077 WP_001050913.1.59098 WP_001050913.1.59124 WP_001050913.1.59133 WP_001050913.1.59135 WP_001050913.1.59146 WP_001050913.1.59157 WP_001050913.1.59175 WP_001050913.1.59178 WP_001050913.1.59187 WP_001050913.1.5920 WP_001050913.1.59203 WP_001050913.1.59213 WP_001050913.1.5925 WP_001050913.1.59269 WP_001050913.1.59284 WP_001050913.1.5930 WP_001050913.1.59311 WP_001050913.1.59327 WP_001050913.1.59329 WP_001050913.1.59334 WP_001050913.1.59337 WP_001050913.1.59363 WP_001050913.1.5938 WP_001050913.1.59380 WP_001050913.1.59397 WP_001050913.1.59398 WP_001050913.1.5940 WP_001050913.1.59401 WP_001050913.1.59414 WP_001050913.1.59441 WP_001050913.1.59457 WP_001050913.1.59459 WP_001050913.1.59462 WP_001050913.1.59464 WP_001050913.1.59467 WP_001050913.1.59478 WP_001050913.1.59489 WP_001050913.1.59498 WP_001050913.1.59540 WP_001050913.1.59546 WP_001050913.1.59547 WP_001050913.1.59567 WP_001050913.1.59594 WP_001050913.1.59598 WP_001050913.1.59603 WP_001050913.1.59609 WP_001050913.1.59624 WP_001050913.1.59629 WP_001050913.1.59643 WP_001050913.1.59663 WP_001050913.1.59668 WP_001050913.1.59669 WP_001050913.1.59671 WP_001050913.1.59697 WP_001050913.1.5972 WP_001050913.1.59736 WP_001050913.1.59787 WP_001050913.1.59803 WP_001050913.1.59810 WP_001050913.1.59819 WP_001050913.1.5982 WP_001050913.1.59822 WP_001050913.1.59864 WP_001050913.1.59874 WP_001050913.1.59881 WP_001050913.1.59886 WP_001050913.1.59896 WP_001050913.1.59907 WP_001050913.1.59915 WP_001050913.1.59921 WP_001050913.1.59945 WP_001050913.1.59977 WP_001050913.1.60001 WP_001050913.1.60006 WP_001050913.1.60022 WP_001050913.1.6006 WP_001050913.1.60086 WP_001050913.1.60101 WP_001050913.1.60107 WP_001050913.1.6011 WP_001050913.1.60118 WP_001050913.1.60123 WP_001050913.1.60124 WP_001050913.1.60147 WP_001050913.1.60149 WP_001050913.1.60156 WP_001050913.1.60157 WP_001050913.1.60158 WP_001050913.1.60165 WP_001050913.1.6017 WP_001050913.1.602 WP_001050913.1.60201 WP_001050913.1.60227 WP_001050913.1.60251 WP_001050913.1.60259 WP_001050913.1.60280 WP_001050913.1.60289 WP_001050913.1.60302 WP_001050913.1.60307 WP_001050913.1.60339 WP_001050913.1.6034 WP_001050913.1.60345 WP_001050913.1.60353 WP_001050913.1.60355 WP_001050913.1.60360 WP_001050913.1.60368 WP_001050913.1.60382 WP_001050913.1.60414 WP_001050913.1.60431 WP_001050913.1.60434 WP_001050913.1.6045 WP_001050913.1.60462 WP_001050913.1.60473 WP_001050913.1.60492 WP_001050913.1.60493 WP_001050913.1.60515 WP_001050913.1.60530 WP_001050913.1.60547 WP_001050913.1.60551 WP_001050913.1.60585 WP_001050913.1.60594 WP_001050913.1.60595 WP_001050913.1.60636 WP_001050913.1.60641 WP_001050913.1.60675 WP_001050913.1.60677 WP_001050913.1.60690 WP_001050913.1.60696 WP_001050913.1.60704 WP_001050913.1.60719 WP_001050913.1.60730 WP_001050913.1.60734 WP_001050913.1.60742 WP_001050913.1.60750 WP_001050913.1.60751 WP_001050913.1.60758 WP_001050913.1.60759 WP_001050913.1.60765 WP_001050913.1.60778 WP_001050913.1.60787 WP_001050913.1.60813 WP_001050913.1.60820 WP_001050913.1.60845 WP_001050913.1.6085 WP_001050913.1.60859 WP_001050913.1.60869 WP_001050913.1.60888 WP_001050913.1.60898 WP_001050913.1.60912 WP_001050913.1.60917 WP_001050913.1.60923 WP_001050913.1.60934 WP_001050913.1.60939 WP_001050913.1.60946 WP_001050913.1.60965 WP_001050913.1.60981 WP_001050913.1.60982 WP_001050913.1.60991 WP_001050913.1.61009 WP_001050913.1.61013 WP_001050913.1.61019 WP_001050913.1.61023 WP_001050913.1.61026 WP_001050913.1.61030 WP_001050913.1.61031 WP_001050913.1.61077 WP_001050913.1.61082 WP_001050913.1.61107 WP_001050913.1.61115 WP_001050913.1.61119 WP_001050913.1.61139 WP_001050913.1.61152 WP_001050913.1.61153 WP_001050913.1.6118 WP_001050913.1.61187 WP_001050913.1.61189 WP_001050913.1.6119 WP_001050913.1.61215 WP_001050913.1.61224 WP_001050913.1.6123 WP_001050913.1.61257 WP_001050913.1.61261 WP_001050913.1.61263 WP_001050913.1.61271 WP_001050913.1.61277 WP_001050913.1.61286 WP_001050913.1.61289 WP_001050913.1.61313 WP_001050913.1.61318 WP_001050913.1.61324 WP_001050913.1.61327 WP_001050913.1.61339 WP_001050913.1.61346 WP_001050913.1.61353 WP_001050913.1.6136 WP_001050913.1.61375 WP_001050913.1.61393 WP_001050913.1.61394 WP_001050913.1.61408 WP_001050913.1.61421 WP_001050913.1.61430 WP_001050913.1.61439 WP_001050913.1.61440 WP_001050913.1.6149 WP_001050913.1.61515 WP_001050913.1.61534 WP_001050913.1.61547 WP_001050913.1.61555 WP_001050913.1.61564 WP_001050913.1.61585 WP_001050913.1.61591 WP_001050913.1.61597 WP_001050913.1.61615 WP_001050913.1.61639 WP_001050913.1.61641 WP_001050913.1.61653 WP_001050913.1.6166 WP_001050913.1.6168 WP_001050913.1.61687 WP_001050913.1.6170 WP_001050913.1.61705 WP_001050913.1.61709 WP_001050913.1.61713 WP_001050913.1.61747 WP_001050913.1.61749 WP_001050913.1.61776 WP_001050913.1.61784 WP_001050913.1.61800 WP_001050913.1.61802 WP_001050913.1.61838 WP_001050913.1.61843 WP_001050913.1.61864 WP_001050913.1.6188 WP_001050913.1.6189 WP_001050913.1.61897 WP_001050913.1.61899 WP_001050913.1.619 WP_001050913.1.61903 WP_001050913.1.61910 WP_001050913.1.61921 WP_001050913.1.61936 WP_001050913.1.61962 WP_001050913.1.61970 WP_001050913.1.61975 WP_001050913.1.61976 WP_001050913.1.61978 WP_001050913.1.62002 WP_001050913.1.6201 WP_001050913.1.62028 WP_001050913.1.62030 WP_001050913.1.62069 WP_001050913.1.62071 WP_001050913.1.6208 WP_001050913.1.62084 WP_001050913.1.62085 WP_001050913.1.62088 WP_001050913.1.62093 WP_001050913.1.62096 WP_001050913.1.62127 WP_001050913.1.62140 WP_001050913.1.62160 WP_001050913.1.62164 WP_001050913.1.62229 WP_001050913.1.62247 WP_001050913.1.62253 WP_001050913.1.62254 WP_001050913.1.62265 WP_001050913.1.62318 WP_001050913.1.6234 WP_001050913.1.62346 WP_001050913.1.62352 WP_001050913.1.62367 WP_001050913.1.62382 WP_001050913.1.62383 WP_001050913.1.62392 WP_001050913.1.62398 WP_001050913.1.62409 WP_001050913.1.62414 WP_001050913.1.62416 WP_001050913.1.62437 WP_001050913.1.62453 WP_001050913.1.62459 WP_001050913.1.62462 WP_001050913.1.62474 WP_001050913.1.62482 WP_001050913.1.62492 WP_001050913.1.62496 WP_001050913.1.6250 WP_001050913.1.62539 WP_001050913.1.62553 WP_001050913.1.62563 WP_001050913.1.62575 WP_001050913.1.62602 WP_001050913.1.62608 WP_001050913.1.62621 WP_001050913.1.62625 WP_001050913.1.62630 WP_001050913.1.62653 WP_001050913.1.6266 WP_001050913.1.62671 WP_001050913.1.62674 WP_001050913.1.6268 WP_001050913.1.62684 WP_001050913.1.62685 WP_001050913.1.62723 WP_001050913.1.62740 WP_001050913.1.62764 WP_001050913.1.62771 WP_001050913.1.62796 WP_001050913.1.62808 WP_001050913.1.62824 WP_001050913.1.62829 WP_001050913.1.62831 WP_001050913.1.62842 WP_001050913.1.62860 WP_001050913.1.62863 WP_001050913.1.62878 WP_001050913.1.62880 WP_001050913.1.62925 WP_001050913.1.62927 WP_001050913.1.62956 WP_001050913.1.62970 WP_001050913.1.62974 WP_001050913.1.6298 WP_001050913.1.62998 WP_001050913.1.63003 WP_001050913.1.63004 WP_001050913.1.63011 WP_001050913.1.63021 WP_001050913.1.63027 WP_001050913.1.63040 WP_001050913.1.63047 WP_001050913.1.63050 WP_001050913.1.63051 WP_001050913.1.63052 WP_001050913.1.63062 WP_001050913.1.63068 WP_001050913.1.63070 WP_001050913.1.63083 WP_001050913.1.63085 WP_001050913.1.631 WP_001050913.1.63107 WP_001050913.1.63120 WP_001050913.1.63131 WP_001050913.1.63132 WP_001050913.1.63139 WP_001050913.1.63140 WP_001050913.1.63142 WP_001050913.1.63143 WP_001050913.1.63162 WP_001050913.1.63170 WP_001050913.1.63182 WP_001050913.1.63190 WP_001050913.1.63195 WP_001050913.1.63215 WP_001050913.1.63228 WP_001050913.1.63244 WP_001050913.1.63255 WP_001050913.1.63266 WP_001050913.1.63273 WP_001050913.1.63279 WP_001050913.1.63280 WP_001050913.1.63288 WP_001050913.1.63289 WP_001050913.1.63296 WP_001050913.1.63304 WP_001050913.1.63307 WP_001050913.1.63313 WP_001050913.1.63319 WP_001050913.1.63322 WP_001050913.1.63324 WP_001050913.1.63333 WP_001050913.1.63335 WP_001050913.1.63337 WP_001050913.1.63341 WP_001050913.1.63364 WP_001050913.1.63365 WP_001050913.1.634 WP_001050913.1.63406 WP_001050913.1.63411 WP_001050913.1.63421 WP_001050913.1.63460 WP_001050913.1.63469 WP_001050913.1.63471 WP_001050913.1.63510 WP_001050913.1.63527 WP_001050913.1.63540 WP_001050913.1.6355 WP_001050913.1.63565 WP_001050913.1.63589 WP_001050913.1.63617 WP_001050913.1.63672 WP_001050913.1.63673 WP_001050913.1.63678 WP_001050913.1.63693 WP_001050913.1.63704 WP_001050913.1.63705 WP_001050913.1.63726 WP_001050913.1.63729 WP_001050913.1.6374 WP_001050913.1.63751 WP_001050913.1.63759 WP_001050913.1.63760 WP_001050913.1.63763 WP_001050913.1.63774 WP_001050913.1.6378 WP_001050913.1.63828 WP_001050913.1.63847 WP_001050913.1.63874 WP_001050913.1.63878 WP_001050913.1.63890 WP_001050913.1.63894 WP_001050913.1.63895 WP_001050913.1.63910 WP_001050913.1.63923 WP_001050913.1.63937 WP_001050913.1.63947 WP_001050913.1.63975 WP_001050913.1.63978 WP_001050913.1.63987 WP_001050913.1.63998 WP_001050913.1.64012 WP_001050913.1.6403 WP_001050913.1.64060 WP_001050913.1.6408 WP_001050913.1.64094 WP_001050913.1.64105 WP_001050913.1.64108 WP_001050913.1.6412 WP_001050913.1.64127 WP_001050913.1.64181 WP_001050913.1.64192 WP_001050913.1.642 WP_001050913.1.64207 WP_001050913.1.64230 WP_001050913.1.64232 WP_001050913.1.64234 WP_001050913.1.64250 WP_001050913.1.64251 WP_001050913.1.64279 WP_001050913.1.64288 WP_001050913.1.64303 WP_001050913.1.64304 WP_001050913.1.64334 WP_001050913.1.64351 WP_001050913.1.64367 WP_001050913.1.64368 WP_001050913.1.6438 WP_001050913.1.64396 WP_001050913.1.64397 WP_001050913.1.64400 WP_001050913.1.64408 WP_001050913.1.64434 WP_001050913.1.64440 WP_001050913.1.64446 WP_001050913.1.64456 WP_001050913.1.64457 WP_001050913.1.64473 WP_001050913.1.645 WP_001050913.1.64525 WP_001050913.1.6453 WP_001050913.1.64537 WP_001050913.1.64549 WP_001050913.1.64565 WP_001050913.1.64583 WP_001050913.1.6459 WP_001050913.1.64598 WP_001050913.1.6462 WP_001050913.1.64630 WP_001050913.1.64631 WP_001050913.1.64665 WP_001050913.1.64686 WP_001050913.1.64720 WP_001050913.1.64765 WP_001050913.1.6479 WP_001050913.1.64811 WP_001050913.1.64845 WP_001050913.1.64858 WP_001050913.1.64860 WP_001050913.1.64873 WP_001050913.1.64879 WP_001050913.1.6488 WP_001050913.1.64893 WP_001050913.1.64896 WP_001050913.1.64897 WP_001050913.1.64899 WP_001050913.1.64911 WP_001050913.1.64928 WP_001050913.1.64935 WP_001050913.1.64951 WP_001050913.1.64961 WP_001050913.1.64988 WP_001050913.1.64994 WP_001050913.1.64996 WP_001050913.1.65025 WP_001050913.1.65033 WP_001050913.1.65038 WP_001050913.1.65044 WP_001050913.1.65046 WP_001050913.1.65076 WP_001050913.1.65082 WP_001050913.1.6509 WP_001050913.1.65125 WP_001050913.1.65132 WP_001050913.1.65153 WP_001050913.1.65156 WP_001050913.1.65158 WP_001050913.1.65164 WP_001050913.1.65180 WP_001050913.1.65193 WP_001050913.1.65203 WP_001050913.1.65214 WP_001050913.1.65217 WP_001050913.1.65233 WP_001050913.1.65243 WP_001050913.1.65259 WP_001050913.1.65274 WP_001050913.1.6531 WP_001050913.1.65317 WP_001050913.1.65346 WP_001050913.1.65361 WP_001050913.1.65387 WP_001050913.1.65406 WP_001050913.1.65407 WP_001050913.1.65419 WP_001050913.1.65423 WP_001050913.1.65432 WP_001050913.1.6544 WP_001050913.1.65443 WP_001050913.1.65448 WP_001050913.1.65451 WP_001050913.1.6547 WP_001050913.1.65470 WP_001050913.1.65504 WP_001050913.1.6551 WP_001050913.1.65512 WP_001050913.1.65520 WP_001050913.1.65541 WP_001050913.1.65544 WP_001050913.1.65555 WP_001050913.1.65562 WP_001050913.1.65585 WP_001050913.1.6559 WP_001050913.1.65599 WP_001050913.1.65616 WP_001050913.1.65629 WP_001050913.1.65643 WP_001050913.1.65653 WP_001050913.1.65656 WP_001050913.1.65663 WP_001050913.1.65675 WP_001050913.1.6568 WP_001050913.1.65689 WP_001050913.1.65693 WP_001050913.1.65700 WP_001050913.1.65703 WP_001050913.1.65704 WP_001050913.1.65705 WP_001050913.1.65713 WP_001050913.1.65717 WP_001050913.1.65734 WP_001050913.1.65750 WP_001050913.1.65752 WP_001050913.1.65769 WP_001050913.1.6578 WP_001050913.1.65808 WP_001050913.1.65809 WP_001050913.1.65842 WP_001050913.1.6585 WP_001050913.1.65856 WP_001050913.1.65870 WP_001050913.1.65879 WP_001050913.1.65886 WP_001050913.1.65892 WP_001050913.1.65922 WP_001050913.1.65928 WP_001050913.1.65930 WP_001050913.1.65931 WP_001050913.1.65935 WP_001050913.1.65947 WP_001050913.1.65948 WP_001050913.1.65965 WP_001050913.1.65986 WP_001050913.1.65990 WP_001050913.1.66009 WP_001050913.1.66014 WP_001050913.1.6603 WP_001050913.1.66035 WP_001050913.1.66054 WP_001050913.1.66069 WP_001050913.1.66081 WP_001050913.1.661 WP_001050913.1.6612 WP_001050913.1.66120 WP_001050913.1.66130 WP_001050913.1.66133 WP_001050913.1.66144 WP_001050913.1.66175 WP_001050913.1.66227 WP_001050913.1.66262 WP_001050913.1.66265 WP_001050913.1.66281 WP_001050913.1.66287 WP_001050913.1.66298 WP_001050913.1.66302 WP_001050913.1.6632 WP_001050913.1.66322 WP_001050913.1.66328 WP_001050913.1.66366 WP_001050913.1.66369 WP_001050913.1.66453 WP_001050913.1.66505 WP_001050913.1.66513 WP_001050913.1.66518 WP_001050913.1.66519 WP_001050913.1.66542 WP_001050913.1.66554 WP_001050913.1.66556 WP_001050913.1.66564 WP_001050913.1.66576 WP_001050913.1.66588 WP_001050913.1.66598 WP_001050913.1.66601 WP_001050913.1.66611 WP_001050913.1.66614 WP_001050913.1.66628 WP_001050913.1.66645 WP_001050913.1.66655 WP_001050913.1.66664 WP_001050913.1.66677 WP_001050913.1.6668 WP_001050913.1.66690 WP_001050913.1.66705 WP_001050913.1.66711 WP_001050913.1.66712 WP_001050913.1.66726 WP_001050913.1.6674 WP_001050913.1.66756 WP_001050913.1.66765 WP_001050913.1.66766 WP_001050913.1.66786 WP_001050913.1.66792 WP_001050913.1.66803 WP_001050913.1.66816 WP_001050913.1.66818 WP_001050913.1.6684 WP_001050913.1.66853 WP_001050913.1.66879 WP_001050913.1.6688 WP_001050913.1.66904 WP_001050913.1.66906 WP_001050913.1.66938 WP_001050913.1.66969 WP_001050913.1.66979 WP_001050913.1.66996 WP_001050913.1.6700 WP_001050913.1.67006 WP_001050913.1.67012 WP_001050913.1.67016 WP_001050913.1.67063 WP_001050913.1.67067 WP_001050913.1.67072 WP_001050913.1.67090 WP_001050913.1.67112 WP_001050913.1.67113 WP_001050913.1.67135 WP_001050913.1.67147 WP_001050913.1.67152 WP_001050913.1.67155 WP_001050913.1.67160 WP_001050913.1.67191 WP_001050913.1.67204 WP_001050913.1.67212 WP_001050913.1.6722 WP_001050913.1.67238 WP_001050913.1.67251 WP_001050913.1.67259 WP_001050913.1.6726 WP_001050913.1.67266 WP_001050913.1.67286 WP_001050913.1.67294 WP_001050913.1.67296 WP_001050913.1.67297 WP_001050913.1.67312 WP_001050913.1.67328 WP_001050913.1.67329 WP_001050913.1.67333 WP_001050913.1.67375 WP_001050913.1.67379 WP_001050913.1.67384 WP_001050913.1.67386 WP_001050913.1.6740 WP_001050913.1.67414 WP_001050913.1.67418 WP_001050913.1.67420 WP_001050913.1.67425 WP_001050913.1.67447 WP_001050913.1.67457 WP_001050913.1.67460 WP_001050913.1.67463 WP_001050913.1.67480 WP_001050913.1.67505 WP_001050913.1.67507 WP_001050913.1.67513 WP_001050913.1.67520 WP_001050913.1.67521 WP_001050913.1.67540 WP_001050913.1.67554 WP_001050913.1.67571 WP_001050913.1.67572 WP_001050913.1.67609 WP_001050913.1.67612 WP_001050913.1.67618 WP_001050913.1.67620 WP_001050913.1.67621 WP_001050913.1.67632 WP_001050913.1.67644 WP_001050913.1.67651 WP_001050913.1.67652 WP_001050913.1.67653 WP_001050913.1.67691 WP_001050913.1.67703 WP_001050913.1.67712 WP_001050913.1.67713 WP_001050913.1.67722 WP_001050913.1.67754 WP_001050913.1.67762 WP_001050913.1.67767 WP_001050913.1.67798 WP_001050913.1.67800 WP_001050913.1.67806 WP_001050913.1.67808 WP_001050913.1.67815 WP_001050913.1.67834 WP_001050913.1.6786 WP_001050913.1.67865 WP_001050913.1.67867 WP_001050913.1.67880 WP_001050913.1.67889 WP_001050913.1.67900 WP_001050913.1.67925 WP_001050913.1.67931 WP_001050913.1.67941 WP_001050913.1.67986 WP_001050913.1.67991 WP_001050913.1.68001 WP_001050913.1.68020 WP_001050913.1.68033 WP_001050913.1.68054 WP_001050913.1.68066 WP_001050913.1.68101 WP_001050913.1.68102 WP_001050913.1.6811 WP_001050913.1.68111 WP_001050913.1.68134 WP_001050913.1.68139 WP_001050913.1.68141 WP_001050913.1.68152 WP_001050913.1.68160 WP_001050913.1.68161 WP_001050913.1.68199 WP_001050913.1.68202 WP_001050913.1.68219 WP_001050913.1.68221 WP_001050913.1.68233 WP_001050913.1.68261 WP_001050913.1.68268 WP_001050913.1.68286 WP_001050913.1.68296 WP_001050913.1.68299 WP_001050913.1.6830 WP_001050913.1.68307 WP_001050913.1.68334 WP_001050913.1.6834 WP_001050913.1.68343 WP_001050913.1.68355 WP_001050913.1.68366 WP_001050913.1.68367 WP_001050913.1.6839 WP_001050913.1.68392 WP_001050913.1.68397 WP_001050913.1.68398 WP_001050913.1.68399 WP_001050913.1.68416 WP_001050913.1.68425 WP_001050913.1.68466 WP_001050913.1.68476 WP_001050913.1.68479 WP_001050913.1.68483 WP_001050913.1.68489 WP_001050913.1.68504 WP_001050913.1.68505 WP_001050913.1.68522 WP_001050913.1.68542 WP_001050913.1.68548 WP_001050913.1.68575 WP_001050913.1.686 WP_001050913.1.68636 WP_001050913.1.68650 WP_001050913.1.68657 WP_001050913.1.68681 WP_001050913.1.68683 WP_001050913.1.68699 WP_001050913.1.68703 WP_001050913.1.68716 WP_001050913.1.68728 WP_001050913.1.68737 WP_001050913.1.68741 WP_001050913.1.68743 WP_001050913.1.68747 WP_001050913.1.68773 WP_001050913.1.68775 WP_001050913.1.68813 WP_001050913.1.68831 WP_001050913.1.68854 WP_001050913.1.68875 WP_001050913.1.68878 WP_001050913.1.68883 WP_001050913.1.68917 WP_001050913.1.68931 WP_001050913.1.68943 WP_001050913.1.68944 WP_001050913.1.68987 WP_001050913.1.68988 WP_001050913.1.68998 WP_001050913.1.69012 WP_001050913.1.69016 WP_001050913.1.69045 WP_001050913.1.69071 WP_001050913.1.69078 WP_001050913.1.69087 WP_001050913.1.69105 WP_001050913.1.69110 WP_001050913.1.69111 WP_001050913.1.69120 WP_001050913.1.69125 WP_001050913.1.69147 WP_001050913.1.6915 WP_001050913.1.69162 WP_001050913.1.6917 WP_001050913.1.69179 WP_001050913.1.69191 WP_001050913.1.69198 WP_001050913.1.69213 WP_001050913.1.69219 WP_001050913.1.69222 WP_001050913.1.69232 WP_001050913.1.69237 WP_001050913.1.69239 WP_001050913.1.69251 WP_001050913.1.69266 WP_001050913.1.69280 WP_001050913.1.69314 WP_001050913.1.69349 WP_001050913.1.69361 WP_001050913.1.69366 WP_001050913.1.69378 WP_001050913.1.69394 WP_001050913.1.69395 WP_001050913.1.69412 WP_001050913.1.69415 WP_001050913.1.69434 WP_001050913.1.69437 WP_001050913.1.69446 WP_001050913.1.69475 WP_001050913.1.69476 WP_001050913.1.69477 WP_001050913.1.69480 WP_001050913.1.69483 WP_001050913.1.69484 WP_001050913.1.69489 WP_001050913.1.695 WP_001050913.1.69520 WP_001050913.1.6953 WP_001050913.1.69546 WP_001050913.1.69552 WP_001050913.1.69559 WP_001050913.1.69563 WP_001050913.1.69598 WP_001050913.1.69622 WP_001050913.1.69639 WP_001050913.1.69679 WP_001050913.1.6968 WP_001050913.1.69683 WP_001050913.1.69685 WP_001050913.1.69718 WP_001050913.1.69721 WP_001050913.1.69724 WP_001050913.1.6980 WP_001050913.1.69820 WP_001050913.1.69823 WP_001050913.1.69830 WP_001050913.1.69842 WP_001050913.1.69877 WP_001050913.1.69878 WP_001050913.1.69882 WP_001050913.1.699 WP_001050913.1.69902 WP_001050913.1.69921 WP_001050913.1.69934 WP_001050913.1.69980 WP_001050913.1.69995 WP_001050913.1.70024 WP_001050913.1.70089 WP_001050913.1.70094 WP_001050913.1.70105 WP_001050913.1.7012 WP_001050913.1.70133 WP_001050913.1.70161 WP_001050913.1.70210 WP_001050913.1.70220 WP_001050913.1.70225 WP_001050913.1.70228 WP_001050913.1.7024 WP_001050913.1.70253 WP_001050913.1.70266 WP_001050913.1.70273 WP_001050913.1.70294 WP_001050913.1.703 WP_001050913.1.7030 WP_001050913.1.70311 WP_001050913.1.70313 WP_001050913.1.70334 WP_001050913.1.70338 WP_001050913.1.7034 WP_001050913.1.70344 WP_001050913.1.70349 WP_001050913.1.70353 WP_001050913.1.70361 WP_001050913.1.70389 WP_001050913.1.7043 WP_001050913.1.70438 WP_001050913.1.70441 WP_001050913.1.70451 WP_001050913.1.70457 WP_001050913.1.70459 WP_001050913.1.7046 WP_001050913.1.70462 WP_001050913.1.70487 WP_001050913.1.70495 WP_001050913.1.70527 WP_001050913.1.7053 WP_001050913.1.70541 WP_001050913.1.70546 WP_001050913.1.70554 WP_001050913.1.70558 WP_001050913.1.70564 WP_001050913.1.70572 WP_001050913.1.706 WP_001050913.1.7061 WP_001050913.1.70611 WP_001050913.1.70635 WP_001050913.1.7064 WP_001050913.1.70651 WP_001050913.1.7067 WP_001050913.1.70672 WP_001050913.1.707 WP_001050913.1.7071 WP_001050913.1.70721 WP_001050913.1.7073 WP_001050913.1.70763 WP_001050913.1.70790 WP_001050913.1.70791 WP_001050913.1.70808 WP_001050913.1.70818 WP_001050913.1.70823 WP_001050913.1.70829 WP_001050913.1.70835 WP_001050913.1.70843 WP_001050913.1.70850 WP_001050913.1.70855 WP_001050913.1.7089 WP_001050913.1.70909 WP_001050913.1.70917 WP_001050913.1.70924 WP_001050913.1.70926 WP_001050913.1.70930 WP_001050913.1.70939 WP_001050913.1.70943 WP_001050913.1.70994 WP_001050913.1.71016 WP_001050913.1.71027 WP_001050913.1.71043 WP_001050913.1.7105 WP_001050913.1.71058 WP_001050913.1.71059 WP_001050913.1.71073 WP_001050913.1.7109 WP_001050913.1.711 WP_001050913.1.71130 WP_001050913.1.71143 WP_001050913.1.71179 WP_001050913.1.71180 WP_001050913.1.71182 WP_001050913.1.7119 WP_001050913.1.71196 WP_001050913.1.7120 WP_001050913.1.71208 WP_001050913.1.71231 WP_001050913.1.71236 WP_001050913.1.7125 WP_001050913.1.71256 WP_001050913.1.71257 WP_001050913.1.71266 WP_001050913.1.71267 WP_001050913.1.71280 WP_001050913.1.71295 WP_001050913.1.71298 WP_001050913.1.71301 WP_001050913.1.71313 WP_001050913.1.71316 WP_001050913.1.71325 WP_001050913.1.71332 WP_001050913.1.71345 WP_001050913.1.71351 WP_001050913.1.71359 WP_001050913.1.71404 WP_001050913.1.71416 WP_001050913.1.71419 WP_001050913.1.71428 WP_001050913.1.71431 WP_001050913.1.71438 WP_001050913.1.71463 WP_001050913.1.71466 WP_001050913.1.71467 WP_001050913.1.71475 WP_001050913.1.71483 WP_001050913.1.7150 WP_001050913.1.71519 WP_001050913.1.71521 WP_001050913.1.71529 WP_001050913.1.71541 WP_001050913.1.71543 WP_001050913.1.71547 WP_001050913.1.71572 WP_001050913.1.71575 WP_001050913.1.7158 WP_001050913.1.71590 WP_001050913.1.71596 WP_001050913.1.71602 WP_001050913.1.7161 WP_001050913.1.7164 WP_001050913.1.71644 WP_001050913.1.71662 WP_001050913.1.71676 WP_001050913.1.71707 WP_001050913.1.71715 WP_001050913.1.71735 WP_001050913.1.71737 WP_001050913.1.71739 WP_001050913.1.71741 WP_001050913.1.71771 WP_001050913.1.71772 WP_001050913.1.71780 WP_001050913.1.71788 WP_001050913.1.7179 WP_001050913.1.71800 WP_001050913.1.71828 WP_001050913.1.71836 WP_001050913.1.71859 WP_001050913.1.71861 WP_001050913.1.71877 WP_001050913.1.71888 WP_001050913.1.71892 WP_001050913.1.71910 WP_001050913.1.71925 WP_001050913.1.71949 WP_001050913.1.71978 WP_001050913.1.71981 WP_001050913.1.71989 WP_001050913.1.72002 WP_001050913.1.72018 WP_001050913.1.72026 WP_001050913.1.72031 WP_001050913.1.72035 WP_001050913.1.72067 WP_001050913.1.72085 WP_001050913.1.72089 WP_001050913.1.72099 WP_001050913.1.72102 WP_001050913.1.72112 WP_001050913.1.72148 WP_001050913.1.72169 WP_001050913.1.72176 WP_001050913.1.72205 WP_001050913.1.72224 WP_001050913.1.72257 WP_001050913.1.72271 WP_001050913.1.72285 WP_001050913.1.72306 WP_001050913.1.72315 WP_001050913.1.72330 WP_001050913.1.72347 WP_001050913.1.7236 WP_001050913.1.72363 WP_001050913.1.72366 WP_001050913.1.72371 WP_001050913.1.7242 WP_001050913.1.72424 WP_001050913.1.72433 WP_001050913.1.72446 WP_001050913.1.72465 WP_001050913.1.72478 WP_001050913.1.72489 WP_001050913.1.72496 WP_001050913.1.72497 WP_001050913.1.72529 WP_001050913.1.72547 WP_001050913.1.72564 WP_001050913.1.7258 WP_001050913.1.7260 WP_001050913.1.72626 WP_001050913.1.72649 WP_001050913.1.72654 WP_001050913.1.72666 WP_001050913.1.72708 WP_001050913.1.72719 WP_001050913.1.72750 WP_001050913.1.72753 WP_001050913.1.72760 WP_001050913.1.72762 WP_001050913.1.7278 WP_001050913.1.72816 WP_001050913.1.72832 WP_001050913.1.72834 WP_001050913.1.72835 WP_001050913.1.72874 WP_001050913.1.72881 WP_001050913.1.72903 WP_001050913.1.72904 WP_001050913.1.7292 WP_001050913.1.72935 WP_001050913.1.7294 WP_001050913.1.72945 WP_001050913.1.72961 WP_001050913.1.72965 WP_001050913.1.72991 WP_001050913.1.73004 WP_001050913.1.73017 WP_001050913.1.73019 WP_001050913.1.73021 WP_001050913.1.73037 WP_001050913.1.73046 WP_001050913.1.73074 WP_001050913.1.73087 WP_001050913.1.73121 WP_001050913.1.73122 WP_001050913.1.73132 WP_001050913.1.73140 WP_001050913.1.73190 WP_001050913.1.73195 WP_001050913.1.73201 WP_001050913.1.73211 WP_001050913.1.73240 WP_001050913.1.73241 WP_001050913.1.73246 WP_001050913.1.7326 WP_001050913.1.73264 WP_001050913.1.73265 WP_001050913.1.73286 WP_001050913.1.73312 WP_001050913.1.73386 WP_001050913.1.73401 WP_001050913.1.73402 WP_001050913.1.73420 WP_001050913.1.73444 WP_001050913.1.73450 WP_001050913.1.73456 WP_001050913.1.73464 WP_001050913.1.73467 WP_001050913.1.73489 WP_001050913.1.73501 WP_001050913.1.73513 WP_001050913.1.73526 WP_001050913.1.73536 WP_001050913.1.73547 WP_001050913.1.73571 WP_001050913.1.73591 WP_001050913.1.736 WP_001050913.1.73610 WP_001050913.1.73639 WP_001050913.1.73640 WP_001050913.1.7365 WP_001050913.1.73674 WP_001050913.1.73685 WP_001050913.1.73687 WP_001050913.1.73693 WP_001050913.1.73694 WP_001050913.1.73733 WP_001050913.1.73736 WP_001050913.1.73740 WP_001050913.1.73759 WP_001050913.1.73786 WP_001050913.1.73789 WP_001050913.1.7380 WP_001050913.1.73834 WP_001050913.1.73853 WP_001050913.1.73858 WP_001050913.1.73868 WP_001050913.1.73880 WP_001050913.1.73885 WP_001050913.1.73900 WP_001050913.1.73902 WP_001050913.1.73910 WP_001050913.1.73920 WP_001050913.1.73921 WP_001050913.1.73940 WP_001050913.1.73949 WP_001050913.1.73961 WP_001050913.1.73969 WP_001050913.1.73971 WP_001050913.1.73976 WP_001050913.1.74004 WP_001050913.1.74006 WP_001050913.1.7401 WP_001050913.1.74010 WP_001050913.1.74013 WP_001050913.1.74025 WP_001050913.1.74027 WP_001050913.1.7406 WP_001050913.1.74073 WP_001050913.1.74081 WP_001050913.1.74085 WP_001050913.1.74138 WP_001050913.1.74155 WP_001050913.1.74157 WP_001050913.1.74158 WP_001050913.1.74161 WP_001050913.1.74172 WP_001050913.1.74173 WP_001050913.1.7418 WP_001050913.1.74183 WP_001050913.1.74187 WP_001050913.1.74221 WP_001050913.1.74234 WP_001050913.1.74237 WP_001050913.1.74242 WP_001050913.1.74257 WP_001050913.1.7427 WP_001050913.1.74273 WP_001050913.1.7428 WP_001050913.1.74284 WP_001050913.1.74295 WP_001050913.1.74327 WP_001050913.1.74338 WP_001050913.1.7434 WP_001050913.1.74353 WP_001050913.1.74356 WP_001050913.1.74380 WP_001050913.1.74390 WP_001050913.1.74429 WP_001050913.1.74456 WP_001050913.1.74457 WP_001050913.1.74468 WP_001050913.1.74474 WP_001050913.1.74486 WP_001050913.1.74497 WP_001050913.1.74510 WP_001050913.1.74533 WP_001050913.1.74556 WP_001050913.1.7457 WP_001050913.1.74576 WP_001050913.1.74590 WP_001050913.1.74610 WP_001050913.1.74638 WP_001050913.1.74645 WP_001050913.1.74681 WP_001050913.1.74693 WP_001050913.1.74696 WP_001050913.1.74704 WP_001050913.1.74731 WP_001050913.1.74747 WP_001050913.1.74758 WP_001050913.1.74761 WP_001050913.1.74770 WP_001050913.1.74775 WP_001050913.1.74781 WP_001050913.1.74785 WP_001050913.1.74797 WP_001050913.1.74802 WP_001050913.1.74808 WP_001050913.1.7482 WP_001050913.1.74840 WP_001050913.1.74849 WP_001050913.1.74866 WP_001050913.1.74874 WP_001050913.1.74890 WP_001050913.1.74899 WP_001050913.1.74911 WP_001050913.1.74922 WP_001050913.1.74924 WP_001050913.1.74961 WP_001050913.1.74963 WP_001050913.1.74978 WP_001050913.1.74985 WP_001050913.1.74994 WP_001050913.1.74999 WP_001050913.1.7500 WP_001050913.1.75006 WP_001050913.1.75038 WP_001050913.1.75044 WP_001050913.1.75048 WP_001050913.1.75052 WP_001050913.1.75070 WP_001050913.1.75091 WP_001050913.1.75093 WP_001050913.1.75111 WP_001050913.1.75122 WP_001050913.1.75127 WP_001050913.1.75131 WP_001050913.1.75132 WP_001050913.1.75141 WP_001050913.1.75186 WP_001050913.1.75227 WP_001050913.1.75252 WP_001050913.1.75294 WP_001050913.1.75298 WP_001050913.1.75304 WP_001050913.1.75320 WP_001050913.1.75323 WP_001050913.1.75327 WP_001050913.1.75349 WP_001050913.1.75351 WP_001050913.1.75356 WP_001050913.1.75365 WP_001050913.1.75369 WP_001050913.1.75375 WP_001050913.1.75379 WP_001050913.1.75399 WP_001050913.1.75409 WP_001050913.1.75411 WP_001050913.1.7542 WP_001050913.1.75438 WP_001050913.1.75440 WP_001050913.1.75481 WP_001050913.1.75506 WP_001050913.1.75509 WP_001050913.1.75521 WP_001050913.1.75538 WP_001050913.1.75542 WP_001050913.1.75551 WP_001050913.1.75566 WP_001050913.1.75571 WP_001050913.1.75590 WP_001050913.1.7561 WP_001050913.1.75623 WP_001050913.1.75647 WP_001050913.1.75649 WP_001050913.1.75652 WP_001050913.1.75680 WP_001050913.1.75685 WP_001050913.1.75692 WP_001050913.1.75704 WP_001050913.1.75728 WP_001050913.1.75743 WP_001050913.1.75770 WP_001050913.1.75775 WP_001050913.1.758 WP_001050913.1.75805 WP_001050913.1.75809 WP_001050913.1.75824 WP_001050913.1.75830 WP_001050913.1.7584 WP_001050913.1.75840 WP_001050913.1.75848 WP_001050913.1.75851 WP_001050913.1.75856 WP_001050913.1.75862 WP_001050913.1.75879 WP_001050913.1.75881 WP_001050913.1.75885 WP_001050913.1.75910 WP_001050913.1.75929 WP_001050913.1.75944 WP_001050913.1.75952 WP_001050913.1.75956 WP_001050913.1.7596 WP_001050913.1.75969 WP_001050913.1.76010 WP_001050913.1.76013 WP_001050913.1.76015 WP_001050913.1.7602 WP_001050913.1.76047 WP_001050913.1.76049 WP_001050913.1.76050 WP_001050913.1.76053 WP_001050913.1.7607 WP_001050913.1.76071 WP_001050913.1.76073 WP_001050913.1.76095 WP_001050913.1.76111 WP_001050913.1.76112 WP_001050913.1.76114 WP_001050913.1.76121 WP_001050913.1.76123 WP_001050913.1.76136 WP_001050913.1.76149 WP_001050913.1.76153 WP_001050913.1.76179 WP_001050913.1.76185 WP_001050913.1.76230 WP_001050913.1.76234 WP_001050913.1.7624 WP_001050913.1.7625 WP_001050913.1.76258 WP_001050913.1.76261 WP_001050913.1.76282 WP_001050913.1.76283 WP_001050913.1.76294 WP_001050913.1.76295 WP_001050913.1.76313 WP_001050913.1.76323 WP_001050913.1.76332 WP_001050913.1.76333 WP_001050913.1.76337 WP_001050913.1.76351 WP_001050913.1.7638 WP_001050913.1.76411 WP_001050913.1.76419 WP_001050913.1.76420 WP_001050913.1.76421 WP_001050913.1.76424 WP_001050913.1.76426 WP_001050913.1.76431 WP_001050913.1.76463 WP_001050913.1.76482 WP_001050913.1.76497 WP_001050913.1.765 WP_001050913.1.76528 WP_001050913.1.7658 WP_001050913.1.76604 WP_001050913.1.76606 WP_001050913.1.76624 WP_001050913.1.76648 WP_001050913.1.76659 WP_001050913.1.76686 WP_001050913.1.76689 WP_001050913.1.76690 WP_001050913.1.76693 WP_001050913.1.76711 WP_001050913.1.76718 WP_001050913.1.7675 WP_001050913.1.76790 WP_001050913.1.76792 WP_001050913.1.76798 WP_001050913.1.768 WP_001050913.1.76803 WP_001050913.1.76816 WP_001050913.1.76825 WP_001050913.1.76829 WP_001050913.1.76839 WP_001050913.1.7686 WP_001050913.1.76867 WP_001050913.1.76869 WP_001050913.1.76872 WP_001050913.1.76876 WP_001050913.1.76878 WP_001050913.1.76895 WP_001050913.1.76920 WP_001050913.1.76921 WP_001050913.1.76937 WP_001050913.1.7694 WP_001050913.1.76944 WP_001050913.1.76952 WP_001050913.1.76998 WP_001050913.1.77013 WP_001050913.1.77020 WP_001050913.1.77027 WP_001050913.1.77031 WP_001050913.1.77041 WP_001050913.1.77043 WP_001050913.1.77060 WP_001050913.1.77062 WP_001050913.1.77069 WP_001050913.1.77072 WP_001050913.1.77112 WP_001050913.1.77137 WP_001050913.1.77144 WP_001050913.1.77145 WP_001050913.1.77176 WP_001050913.1.77183 WP_001050913.1.77190 WP_001050913.1.77203 WP_001050913.1.77229 WP_001050913.1.77256 WP_001050913.1.77259 WP_001050913.1.77297 WP_001050913.1.77298 WP_001050913.1.77315 WP_001050913.1.77331 WP_001050913.1.77346 WP_001050913.1.77354 WP_001050913.1.77359 WP_001050913.1.77388 WP_001050913.1.77416 WP_001050913.1.77426 WP_001050913.1.77446 WP_001050913.1.7745 WP_001050913.1.7746 WP_001050913.1.77460 WP_001050913.1.77485 WP_001050913.1.77489 WP_001050913.1.77497 WP_001050913.1.77498 WP_001050913.1.7752 WP_001050913.1.77520 WP_001050913.1.77527 WP_001050913.1.77532 WP_001050913.1.77533 WP_001050913.1.77536 WP_001050913.1.77572 WP_001050913.1.77583 WP_001050913.1.77603 WP_001050913.1.77606 WP_001050913.1.77650 WP_001050913.1.77674 WP_001050913.1.77733 WP_001050913.1.77735 WP_001050913.1.77738 WP_001050913.1.7774 WP_001050913.1.77743 WP_001050913.1.77745 WP_001050913.1.77763 WP_001050913.1.77791 WP_001050913.1.77805 WP_001050913.1.77814 WP_001050913.1.77818 WP_001050913.1.77822 WP_001050913.1.77827 WP_001050913.1.77832 WP_001050913.1.77848 WP_001050913.1.7785 WP_001050913.1.77858 WP_001050913.1.7786 WP_001050913.1.77860 WP_001050913.1.7787 WP_001050913.1.77882 WP_001050913.1.77883 WP_001050913.1.77896 WP_001050913.1.77908 WP_001050913.1.77915 WP_001050913.1.77922 WP_001050913.1.77930 WP_001050913.1.77952 WP_001050913.1.77957 WP_001050913.1.77986 WP_001050913.1.78002 WP_001050913.1.78038 WP_001050913.1.78050 WP_001050913.1.78054 WP_001050913.1.78067 WP_001050913.1.78082 WP_001050913.1.78091 WP_001050913.1.78095 WP_001050913.1.7810 WP_001050913.1.78116 WP_001050913.1.78126 WP_001050913.1.78164 WP_001050913.1.78173 WP_001050913.1.78179 WP_001050913.1.78185 WP_001050913.1.78189 WP_001050913.1.78194 WP_001050913.1.78207 WP_001050913.1.78208 WP_001050913.1.78210 WP_001050913.1.78252 WP_001050913.1.78254 WP_001050913.1.78257 WP_001050913.1.7827 WP_001050913.1.78304 WP_001050913.1.78311 WP_001050913.1.78324 WP_001050913.1.7833 WP_001050913.1.78330 WP_001050913.1.78332 WP_001050913.1.78365 WP_001050913.1.78371 WP_001050913.1.78392 WP_001050913.1.78404 WP_001050913.1.78434 WP_001050913.1.78436 WP_001050913.1.78458 WP_001050913.1.78470 WP_001050913.1.78478 WP_001050913.1.78489 WP_001050913.1.78494 WP_001050913.1.7850 WP_001050913.1.78513 WP_001050913.1.7853 WP_001050913.1.78550 WP_001050913.1.78558 WP_001050913.1.7857 WP_001050913.1.78573 WP_001050913.1.78582 WP_001050913.1.78585 WP_001050913.1.78592 WP_001050913.1.78596 WP_001050913.1.78598 WP_001050913.1.78604 WP_001050913.1.78625 WP_001050913.1.78633 WP_001050913.1.78638 WP_001050913.1.78653 WP_001050913.1.78667 WP_001050913.1.7868 WP_001050913.1.78685 WP_001050913.1.78708 WP_001050913.1.78728 WP_001050913.1.78731 WP_001050913.1.78736 WP_001050913.1.78763 WP_001050913.1.78803 WP_001050913.1.78816 WP_001050913.1.78819 WP_001050913.1.78841 WP_001050913.1.78872 WP_001050913.1.7888 WP_001050913.1.78897 WP_001050913.1.78920 WP_001050913.1.78934 WP_001050913.1.78937 WP_001050913.1.78946 WP_001050913.1.78978 WP_001050913.1.78983 WP_001050913.1.78985 WP_001050913.1.78991 WP_001050913.1.78995 WP_001050913.1.7900 WP_001050913.1.79006 WP_001050913.1.79037 WP_001050913.1.79038 WP_001050913.1.7905 WP_001050913.1.79051 WP_001050913.1.79059 WP_001050913.1.79085 WP_001050913.1.79110 WP_001050913.1.79114 WP_001050913.1.79131 WP_001050913.1.79132 WP_001050913.1.7914 WP_001050913.1.79143 WP_001050913.1.79156 WP_001050913.1.79170 WP_001050913.1.79178 WP_001050913.1.79192 WP_001050913.1.79197 WP_001050913.1.79208 WP_001050913.1.79223 WP_001050913.1.79227 WP_001050913.1.79244 WP_001050913.1.79270 WP_001050913.1.79275 WP_001050913.1.79285 WP_001050913.1.7930 WP_001050913.1.7931 WP_001050913.1.79310 WP_001050913.1.79314 WP_001050913.1.79320 WP_001050913.1.79322 WP_001050913.1.79332 WP_001050913.1.79334 WP_001050913.1.7934 WP_001050913.1.79341 WP_001050913.1.79367 WP_001050913.1.79374 WP_001050913.1.79378 WP_001050913.1.79379 WP_001050913.1.79400 WP_001050913.1.79402 WP_001050913.1.79407 WP_001050913.1.79408 WP_001050913.1.79436 WP_001050913.1.79452 WP_001050913.1.79461 WP_001050913.1.79473 WP_001050913.1.79476 WP_001050913.1.79487 WP_001050913.1.79539 WP_001050913.1.79543 WP_001050913.1.79552 WP_001050913.1.79554 WP_001050913.1.79556 WP_001050913.1.79566 WP_001050913.1.79627 WP_001050913.1.79638 WP_001050913.1.79646 WP_001050913.1.79662 WP_001050913.1.79664 WP_001050913.1.79672 WP_001050913.1.79676 WP_001050913.1.79677 WP_001050913.1.79706 WP_001050913.1.79731 WP_001050913.1.79737 WP_001050913.1.79763 WP_001050913.1.7981 WP_001050913.1.79810 WP_001050913.1.79815 WP_001050913.1.79822 WP_001050913.1.79831 WP_001050913.1.79834 WP_001050913.1.79837 WP_001050913.1.79854 WP_001050913.1.79855 WP_001050913.1.79896 WP_001050913.1.79904 WP_001050913.1.79911 WP_001050913.1.79919 WP_001050913.1.7992 WP_001050913.1.79949 WP_001050913.1.79961 WP_001050913.1.79971 WP_001050913.1.79991 WP_001050913.1.80000 WP_001050913.1.80009 WP_001050913.1.80013 WP_001050913.1.80029 WP_001050913.1.80032 WP_001050913.1.80034 WP_001050913.1.80042 WP_001050913.1.80079 WP_001050913.1.80086 WP_001050913.1.80109 WP_001050913.1.80119 WP_001050913.1.80120 WP_001050913.1.80122 WP_001050913.1.80124 WP_001050913.1.80127 WP_001050913.1.80146 WP_001050913.1.80147 WP_001050913.1.80152 WP_001050913.1.80159 WP_001050913.1.80178 WP_001050913.1.80181 WP_001050913.1.80184 WP_001050913.1.80193 WP_001050913.1.80203 WP_001050913.1.80206 WP_001050913.1.80244 WP_001050913.1.80286 WP_001050913.1.80287 WP_001050913.1.80290 WP_001050913.1.80297 WP_001050913.1.8030 WP_001050913.1.80303 WP_001050913.1.80308 WP_001050913.1.8031 WP_001050913.1.80316 WP_001050913.1.80317 WP_001050913.1.80318 WP_001050913.1.80345 WP_001050913.1.8035 WP_001050913.1.80358 WP_001050913.1.80378 WP_001050913.1.80389 WP_001050913.1.80393 WP_001050913.1.8040 WP_001050913.1.80407 WP_001050913.1.80414 WP_001050913.1.8043 WP_001050913.1.80434 WP_001050913.1.8045 WP_001050913.1.80472 WP_001050913.1.80482 WP_001050913.1.80521 WP_001050913.1.80530 WP_001050913.1.80582 WP_001050913.1.80647 WP_001050913.1.8065 WP_001050913.1.80653 WP_001050913.1.8066 WP_001050913.1.80680 WP_001050913.1.80687 WP_001050913.1.80717 WP_001050913.1.80734 WP_001050913.1.80745 WP_001050913.1.80761 WP_001050913.1.80762 WP_001050913.1.80763 WP_001050913.1.8077 WP_001050913.1.80781 WP_001050913.1.80786 WP_001050913.1.80793 WP_001050913.1.80801 WP_001050913.1.80828 WP_001050913.1.80833 WP_001050913.1.8084 WP_001050913.1.80845 WP_001050913.1.8085 WP_001050913.1.80872 WP_001050913.1.80899 WP_001050913.1.809 WP_001050913.1.80962 WP_001050913.1.80972 WP_001050913.1.80979 WP_001050913.1.80980 WP_001050913.1.81010 WP_001050913.1.81022 WP_001050913.1.81049 WP_001050913.1.81052 WP_001050913.1.81055 WP_001050913.1.81064 WP_001050913.1.81065 WP_001050913.1.81085 WP_001050913.1.81092 WP_001050913.1.81097 WP_001050913.1.81114 WP_001050913.1.81132 WP_001050913.1.81151 WP_001050913.1.81157 WP_001050913.1.81171 WP_001050913.1.81172 WP_001050913.1.81176 WP_001050913.1.81184 WP_001050913.1.81224 WP_001050913.1.81228 WP_001050913.1.81234 WP_001050913.1.81243 WP_001050913.1.8125 WP_001050913.1.81252 WP_001050913.1.81288 WP_001050913.1.81344 WP_001050913.1.8135 WP_001050913.1.81379 WP_001050913.1.81384 WP_001050913.1.81385 WP_001050913.1.81387 WP_001050913.1.81389 WP_001050913.1.8142 WP_001050913.1.81436 WP_001050913.1.8144 WP_001050913.1.81464 WP_001050913.1.81467 WP_001050913.1.81508 WP_001050913.1.81522 WP_001050913.1.81532 WP_001050913.1.81549 WP_001050913.1.81572 WP_001050913.1.81574 WP_001050913.1.81599 WP_001050913.1.8160 WP_001050913.1.81604 WP_001050913.1.81610 WP_001050913.1.81619 WP_001050913.1.81631 WP_001050913.1.81637 WP_001050913.1.81645 WP_001050913.1.81651 WP_001050913.1.81718 WP_001050913.1.81734 WP_001050913.1.81738 WP_001050913.1.81740 WP_001050913.1.81758 WP_001050913.1.8176 WP_001050913.1.81767 WP_001050913.1.81789 WP_001050913.1.8180 WP_001050913.1.81800 WP_001050913.1.81810 WP_001050913.1.81812 WP_001050913.1.81829 WP_001050913.1.81831 WP_001050913.1.81838 WP_001050913.1.81847 WP_001050913.1.8185 WP_001050913.1.81861 WP_001050913.1.81870 WP_001050913.1.8188 WP_001050913.1.81897 WP_001050913.1.81903 WP_001050913.1.81904 WP_001050913.1.81905 WP_001050913.1.81906 WP_001050913.1.81919 WP_001050913.1.81940 WP_001050913.1.81944 WP_001050913.1.81955 WP_001050913.1.81969 WP_001050913.1.81982 WP_001050913.1.81990 WP_001050913.1.81996 WP_001050913.1.81999 WP_001050913.1.82009 WP_001050913.1.82015 WP_001050913.1.82017 WP_001050913.1.82026 WP_001050913.1.82053 WP_001050913.1.82058 WP_001050913.1.8206 WP_001050913.1.82103 WP_001050913.1.8212 WP_001050913.1.82121 WP_001050913.1.8213 WP_001050913.1.82161 WP_001050913.1.82167 WP_001050913.1.82174 WP_001050913.1.82184 WP_001050913.1.82219 WP_001050913.1.82247 WP_001050913.1.82253 WP_001050913.1.82259 WP_001050913.1.82278 WP_001050913.1.82281 WP_001050913.1.82301 WP_001050913.1.82315 WP_001050913.1.82321 WP_001050913.1.82340 WP_001050913.1.82349 WP_001050913.1.82354 WP_001050913.1.82358 WP_001050913.1.82368 WP_001050913.1.82406 WP_001050913.1.8244 WP_001050913.1.82441 WP_001050913.1.82447 WP_001050913.1.82455 WP_001050913.1.82458 WP_001050913.1.8246 WP_001050913.1.82467 WP_001050913.1.82468 WP_001050913.1.82472 WP_001050913.1.82525 WP_001050913.1.82548 WP_001050913.1.82558 WP_001050913.1.8261 WP_001050913.1.82612 WP_001050913.1.8265 WP_001050913.1.8266 WP_001050913.1.82664 WP_001050913.1.82665 WP_001050913.1.82678 WP_001050913.1.82709 WP_001050913.1.82724 WP_001050913.1.82760 WP_001050913.1.82762 WP_001050913.1.82768 WP_001050913.1.82775 WP_001050913.1.82796 WP_001050913.1.8280 WP_001050913.1.82824 WP_001050913.1.82829 WP_001050913.1.82835 WP_001050913.1.82855 WP_001050913.1.82862 WP_001050913.1.8288 WP_001050913.1.8289 WP_001050913.1.82916 WP_001050913.1.82930 WP_001050913.1.82931 WP_001050913.1.82941 WP_001050913.1.82976 WP_001050913.1.82980 WP_001050913.1.82984 WP_001050913.1.82997 WP_001050913.1.82999 WP_001050913.1.83011 WP_001050913.1.83013 WP_001050913.1.8302 WP_001050913.1.83021 WP_001050913.1.83046 WP_001050913.1.83053 WP_001050913.1.83054 WP_001050913.1.83066 WP_001050913.1.83078 WP_001050913.1.83088 WP_001050913.1.8310 WP_001050913.1.83103 WP_001050913.1.83152 WP_001050913.1.83153 WP_001050913.1.8318 WP_001050913.1.83185 WP_001050913.1.8319 WP_001050913.1.83193 WP_001050913.1.83203 WP_001050913.1.83234 WP_001050913.1.83243 WP_001050913.1.83249 WP_001050913.1.83250 WP_001050913.1.8328 WP_001050913.1.83291 WP_001050913.1.83314 WP_001050913.1.83316 WP_001050913.1.83352 WP_001050913.1.83359 WP_001050913.1.83372 WP_001050913.1.83405 WP_001050913.1.83416 WP_001050913.1.83417 WP_001050913.1.83418 WP_001050913.1.8346 WP_001050913.1.83467 WP_001050913.1.83468 WP_001050913.1.83472 WP_001050913.1.83475 WP_001050913.1.83476 WP_001050913.1.83479 WP_001050913.1.83484 WP_001050913.1.83508 WP_001050913.1.83517 WP_001050913.1.83520 WP_001050913.1.83541 WP_001050913.1.83553 WP_001050913.1.83592 WP_001050913.1.83593 WP_001050913.1.83597 WP_001050913.1.83624 WP_001050913.1.83626 WP_001050913.1.83645 WP_001050913.1.83646 WP_001050913.1.83652 WP_001050913.1.83653 WP_001050913.1.8366 WP_001050913.1.83674 WP_001050913.1.83676 WP_001050913.1.83714 WP_001050913.1.83720 WP_001050913.1.83728 WP_001050913.1.83750 WP_001050913.1.83756 WP_001050913.1.83758 WP_001050913.1.83763 WP_001050913.1.83769 WP_001050913.1.83770 WP_001050913.1.83775 WP_001050913.1.83778 WP_001050913.1.83788 WP_001050913.1.83792 WP_001050913.1.83797 WP_001050913.1.83804 WP_001050913.1.83816 WP_001050913.1.83825 WP_001050913.1.83837 WP_001050913.1.83844 WP_001050913.1.83852 WP_001050913.1.83864 WP_001050913.1.83865 WP_001050913.1.83868 WP_001050913.1.83881 WP_001050913.1.83886 WP_001050913.1.83902 WP_001050913.1.83912 WP_001050913.1.83917 WP_001050913.1.83919 WP_001050913.1.83925 WP_001050913.1.83928 WP_001050913.1.83935 WP_001050913.1.83955 WP_001050913.1.83980 WP_001050913.1.83984 WP_001050913.1.83989 WP_001050913.1.84010 WP_001050913.1.84025 WP_001050913.1.84041 WP_001050913.1.84049 WP_001050913.1.84054 WP_001050913.1.84064 WP_001050913.1.84067 WP_001050913.1.84068 WP_001050913.1.84118 WP_001050913.1.84129 WP_001050913.1.84144 WP_001050913.1.84161 WP_001050913.1.84163 WP_001050913.1.84188 WP_001050913.1.84194 WP_001050913.1.84275 WP_001050913.1.84284 WP_001050913.1.8432 WP_001050913.1.84322 WP_001050913.1.84415 WP_001050913.1.84416 WP_001050913.1.84418 WP_001050913.1.84442 WP_001050913.1.84445 WP_001050913.1.84451 WP_001050913.1.84508 WP_001050913.1.84509 WP_001050913.1.84555 WP_001050913.1.84563 WP_001050913.1.84570 WP_001050913.1.84578 WP_001050913.1.84590 WP_001050913.1.84596 WP_001050913.1.84602 WP_001050913.1.84608 WP_001050913.1.84612 WP_001050913.1.8462 WP_001050913.1.84625 WP_001050913.1.84630 WP_001050913.1.84638 WP_001050913.1.84648 WP_001050913.1.84652 WP_001050913.1.84662 WP_001050913.1.84673 WP_001050913.1.84679 WP_001050913.1.8468 WP_001050913.1.84682 WP_001050913.1.84696 WP_001050913.1.84700 WP_001050913.1.84714 WP_001050913.1.84736 WP_001050913.1.8475 WP_001050913.1.84752 WP_001050913.1.84757 WP_001050913.1.84761 WP_001050913.1.84770 WP_001050913.1.84815 WP_001050913.1.84826 WP_001050913.1.84844 WP_001050913.1.84847 WP_001050913.1.84854 WP_001050913.1.84874 WP_001050913.1.84889 WP_001050913.1.84907 WP_001050913.1.84922 WP_001050913.1.84924 WP_001050913.1.8493 WP_001050913.1.84943 WP_001050913.1.84951 WP_001050913.1.8496 WP_001050913.1.84975 WP_001050913.1.84978 WP_001050913.1.85017 WP_001050913.1.85022 WP_001050913.1.85026 WP_001050913.1.85045 WP_001050913.1.85047 WP_001050913.1.85056 WP_001050913.1.85070 WP_001050913.1.85083 WP_001050913.1.85099 WP_001050913.1.851 WP_001050913.1.85113 WP_001050913.1.85132 WP_001050913.1.85133 WP_001050913.1.85135 WP_001050913.1.85144 WP_001050913.1.85151 WP_001050913.1.85173 WP_001050913.1.85198 WP_001050913.1.85213 WP_001050913.1.85224 WP_001050913.1.85226 WP_001050913.1.85229 WP_001050913.1.85231 WP_001050913.1.85238 WP_001050913.1.85265 WP_001050913.1.85289 WP_001050913.1.85292 WP_001050913.1.85294 WP_001050913.1.85297 WP_001050913.1.85302 WP_001050913.1.85331 WP_001050913.1.85351 WP_001050913.1.85354 WP_001050913.1.85374 WP_001050913.1.85375 WP_001050913.1.85376 WP_001050913.1.85383 WP_001050913.1.85391 WP_001050913.1.85395 WP_001050913.1.85401 WP_001050913.1.85404 WP_001050913.1.85409 WP_001050913.1.85425 WP_001050913.1.85440 WP_001050913.1.85441 WP_001050913.1.85445 WP_001050913.1.85455 WP_001050913.1.85462 WP_001050913.1.85471 WP_001050913.1.85474 WP_001050913.1.85485 WP_001050913.1.85492 WP_001050913.1.85506 WP_001050913.1.8551 WP_001050913.1.85515 WP_001050913.1.85519 WP_001050913.1.85542 WP_001050913.1.85547 WP_001050913.1.85549 WP_001050913.1.85555 WP_001050913.1.85562 WP_001050913.1.85596 WP_001050913.1.85607 WP_001050913.1.85611 WP_001050913.1.85634 WP_001050913.1.85649 WP_001050913.1.85678 WP_001050913.1.85705 WP_001050913.1.8572 WP_001050913.1.85730 WP_001050913.1.85732 WP_001050913.1.85758 WP_001050913.1.8576 WP_001050913.1.85795 WP_001050913.1.85796 WP_001050913.1.85809 WP_001050913.1.85816 WP_001050913.1.85825 WP_001050913.1.85834 WP_001050913.1.85844 WP_001050913.1.85858 WP_001050913.1.85873 WP_001050913.1.85906 WP_001050913.1.85924 WP_001050913.1.85927 WP_001050913.1.85950 WP_001050913.1.85971 WP_001050913.1.85980 WP_001050913.1.85993 WP_001050913.1.86018 WP_001050913.1.86036 WP_001050913.1.86042 WP_001050913.1.86072 WP_001050913.1.86086 WP_001050913.1.8609 WP_001050913.1.86101 WP_001050913.1.86106 WP_001050913.1.86123 WP_001050913.1.86136 WP_001050913.1.86144 WP_001050913.1.86153 WP_001050913.1.86154 WP_001050913.1.86158 WP_001050913.1.8617 WP_001050913.1.86178 WP_001050913.1.86188 WP_001050913.1.86197 WP_001050913.1.86207 WP_001050913.1.86209 WP_001050913.1.86241 WP_001050913.1.86248 WP_001050913.1.86256 WP_001050913.1.8627 WP_001050913.1.86270 WP_001050913.1.86281 WP_001050913.1.86304 WP_001050913.1.86315 WP_001050913.1.86331 WP_001050913.1.86344 WP_001050913.1.86363 WP_001050913.1.86367 WP_001050913.1.86378 WP_001050913.1.8641 WP_001050913.1.8643 WP_001050913.1.86439 WP_001050913.1.86455 WP_001050913.1.86482 WP_001050913.1.86505 WP_001050913.1.86523 WP_001050913.1.86526 WP_001050913.1.86531 WP_001050913.1.86542 WP_001050913.1.86606 WP_001050913.1.86628 WP_001050913.1.86629 WP_001050913.1.8663 WP_001050913.1.86664 WP_001050913.1.86704 WP_001050913.1.86706 WP_001050913.1.86745 WP_001050913.1.86754 WP_001050913.1.86792 WP_001050913.1.86793 WP_001050913.1.86795 WP_001050913.1.8681 WP_001050913.1.86838 WP_001050913.1.86881 WP_001050913.1.8690 WP_001050913.1.86910 WP_001050913.1.86911 WP_001050913.1.86916 WP_001050913.1.86940 WP_001050913.1.86942 WP_001050913.1.86955 WP_001050913.1.86961 WP_001050913.1.86968 WP_001050913.1.86977 WP_001050913.1.8699 WP_001050913.1.86999 WP_001050913.1.87021 WP_001050913.1.87022 WP_001050913.1.87072 WP_001050913.1.87088 WP_001050913.1.87090 WP_001050913.1.87096 WP_001050913.1.87097 WP_001050913.1.87100 WP_001050913.1.87110 WP_001050913.1.87119 WP_001050913.1.8712 WP_001050913.1.87122 WP_001050913.1.87133 WP_001050913.1.87141 WP_001050913.1.87168 WP_001050913.1.87175 WP_001050913.1.87190 WP_001050913.1.8720 WP_001050913.1.87221 WP_001050913.1.87236 WP_001050913.1.87250 WP_001050913.1.87260 WP_001050913.1.87261 WP_001050913.1.87263 WP_001050913.1.87264 WP_001050913.1.87272 WP_001050913.1.87285 WP_001050913.1.87290 WP_001050913.1.87296 WP_001050913.1.8731 WP_001050913.1.87363 WP_001050913.1.87372 WP_001050913.1.87378 WP_001050913.1.87388 WP_001050913.1.87391 WP_001050913.1.87396 WP_001050913.1.87397 WP_001050913.1.87425 WP_001050913.1.87434 WP_001050913.1.87457 WP_001050913.1.87461 WP_001050913.1.87466 WP_001050913.1.87475 WP_001050913.1.87486 WP_001050913.1.87497 WP_001050913.1.87498 WP_001050913.1.87502 WP_001050913.1.87508 WP_001050913.1.87511 WP_001050913.1.87515 WP_001050913.1.8753 WP_001050913.1.87534 WP_001050913.1.87541 WP_001050913.1.87543 WP_001050913.1.8757 WP_001050913.1.87579 WP_001050913.1.87593 WP_001050913.1.87595 WP_001050913.1.87601 WP_001050913.1.87623 WP_001050913.1.87636 WP_001050913.1.8764 WP_001050913.1.87647 WP_001050913.1.87682 WP_001050913.1.8770 WP_001050913.1.87710 WP_001050913.1.87718 WP_001050913.1.87734 WP_001050913.1.87735 WP_001050913.1.87740 WP_001050913.1.87745 WP_001050913.1.87748 WP_001050913.1.87764 WP_001050913.1.87782 WP_001050913.1.8779 WP_001050913.1.87802 WP_001050913.1.87808 WP_001050913.1.87828 WP_001050913.1.87838 WP_001050913.1.87841 WP_001050913.1.87843 WP_001050913.1.87854 WP_001050913.1.87865 WP_001050913.1.87879 WP_001050913.1.8791 WP_001050913.1.87912 WP_001050913.1.87937 WP_001050913.1.87943 WP_001050913.1.87948 WP_001050913.1.87963 WP_001050913.1.87964 WP_001050913.1.87967 WP_001050913.1.87972 WP_001050913.1.87985 WP_001050913.1.87995 WP_001050913.1.88013 WP_001050913.1.88032 WP_001050913.1.88061 WP_001050913.1.88101 WP_001050913.1.88114 WP_001050913.1.88150 WP_001050913.1.88166 WP_001050913.1.88169 WP_001050913.1.8820 WP_001050913.1.88212 WP_001050913.1.88240 WP_001050913.1.88270 WP_001050913.1.88279 WP_001050913.1.88309 WP_001050913.1.88311 WP_001050913.1.88317 WP_001050913.1.88319 WP_001050913.1.88328 WP_001050913.1.88339 WP_001050913.1.88348 WP_001050913.1.88351 WP_001050913.1.88367 WP_001050913.1.88371 WP_001050913.1.88373 WP_001050913.1.88375 WP_001050913.1.88380 WP_001050913.1.88395 WP_001050913.1.88418 WP_001050913.1.88430 WP_001050913.1.88440 WP_001050913.1.88445 WP_001050913.1.88449 WP_001050913.1.88455 WP_001050913.1.8847 WP_001050913.1.88471 WP_001050913.1.88473 WP_001050913.1.88478 WP_001050913.1.88480 WP_001050913.1.88490 WP_001050913.1.88498 WP_001050913.1.88504 WP_001050913.1.88518 WP_001050913.1.88536 WP_001050913.1.88555 WP_001050913.1.88558 WP_001050913.1.88560 WP_001050913.1.88563 WP_001050913.1.8857 WP_001050913.1.88572 WP_001050913.1.88580 WP_001050913.1.88583 WP_001050913.1.88585 WP_001050913.1.8859 WP_001050913.1.88599 WP_001050913.1.88600 WP_001050913.1.88614 WP_001050913.1.88623 WP_001050913.1.88636 WP_001050913.1.88638 WP_001050913.1.88642 WP_001050913.1.88671 WP_001050913.1.88694 WP_001050913.1.88696 WP_001050913.1.8872 WP_001050913.1.88738 WP_001050913.1.88739 WP_001050913.1.88753 WP_001050913.1.88761 WP_001050913.1.8877 WP_001050913.1.88771 WP_001050913.1.88781 WP_001050913.1.88805 WP_001050913.1.88827 WP_001050913.1.88843 WP_001050913.1.88856 WP_001050913.1.88859 WP_001050913.1.8886 WP_001050913.1.88861 WP_001050913.1.88871 WP_001050913.1.88874 WP_001050913.1.88878 WP_001050913.1.8888 WP_001050913.1.88881 WP_001050913.1.88897 WP_001050913.1.88912 WP_001050913.1.88922 WP_001050913.1.88934 WP_001050913.1.88954 WP_001050913.1.88959 WP_001050913.1.88962 WP_001050913.1.88987 WP_001050913.1.8899 WP_001050913.1.8900 WP_001050913.1.89012 WP_001050913.1.89024 WP_001050913.1.89027 WP_001050913.1.89036 WP_001050913.1.8904 WP_001050913.1.89070 WP_001050913.1.89086 WP_001050913.1.89103 WP_001050913.1.89108 WP_001050913.1.8913 WP_001050913.1.89133 WP_001050913.1.89139 WP_001050913.1.89164 WP_001050913.1.89173 WP_001050913.1.8918 WP_001050913.1.89181 WP_001050913.1.89184 WP_001050913.1.89194 WP_001050913.1.89195 WP_001050913.1.89204 WP_001050913.1.89216 WP_001050913.1.89229 WP_001050913.1.89235 WP_001050913.1.89237 WP_001050913.1.8924 WP_001050913.1.89258 WP_001050913.1.89284 WP_001050913.1.8929 WP_001050913.1.89290 WP_001050913.1.89347 WP_001050913.1.89348 WP_001050913.1.89350 WP_001050913.1.89372 WP_001050913.1.89390 WP_001050913.1.89404 WP_001050913.1.89414 WP_001050913.1.89433 WP_001050913.1.89439 WP_001050913.1.89476 WP_001050913.1.8950 WP_001050913.1.8953 WP_001050913.1.89537 WP_001050913.1.89544 WP_001050913.1.89556 WP_001050913.1.89557 WP_001050913.1.89559 WP_001050913.1.89603 WP_001050913.1.89628 WP_001050913.1.89651 WP_001050913.1.89655 WP_001050913.1.89672 WP_001050913.1.89678 WP_001050913.1.89686 WP_001050913.1.897 WP_001050913.1.89715 WP_001050913.1.89726 WP_001050913.1.89730 WP_001050913.1.89738 WP_001050913.1.89754 WP_001050913.1.89779 WP_001050913.1.89794 WP_001050913.1.89799 WP_001050913.1.898 WP_001050913.1.89857 WP_001050913.1.8986 WP_001050913.1.89860 WP_001050913.1.89863 WP_001050913.1.89874 WP_001050913.1.89883 WP_001050913.1.8990 WP_001050913.1.89908 WP_001050913.1.89924 WP_001050913.1.89933 WP_001050913.1.89935 WP_001050913.1.89949 WP_001050913.1.89950 WP_001050913.1.89960 WP_001050913.1.90005 WP_001050913.1.90018 WP_001050913.1.90038 WP_001050913.1.90046 WP_001050913.1.90055 WP_001050913.1.90069 WP_001050913.1.90091 WP_001050913.1.90095 WP_001050913.1.90112 WP_001050913.1.90131 WP_001050913.1.90145 WP_001050913.1.90148 WP_001050913.1.90161 WP_001050913.1.90173 WP_001050913.1.90174 WP_001050913.1.90180 WP_001050913.1.90215 WP_001050913.1.90217 WP_001050913.1.9022 WP_001050913.1.90232 WP_001050913.1.90243 WP_001050913.1.90244 WP_001050913.1.90246 WP_001050913.1.90250 WP_001050913.1.90253 WP_001050913.1.90269 WP_001050913.1.90276 WP_001050913.1.9030 WP_001050913.1.90307 WP_001050913.1.90345 WP_001050913.1.90367 WP_001050913.1.90370 WP_001050913.1.90386 WP_001050913.1.90432 WP_001050913.1.90447 WP_001050913.1.90454 WP_001050913.1.90473 WP_001050913.1.90475 WP_001050913.1.90488 WP_001050913.1.90506 WP_001050913.1.90514 WP_001050913.1.90517 WP_001050913.1.90533 WP_001050913.1.90544 WP_001050913.1.90548 WP_001050913.1.9055 WP_001050913.1.90554 WP_001050913.1.90562 WP_001050913.1.90604 WP_001050913.1.90647 WP_001050913.1.90660 WP_001050913.1.90683 WP_001050913.1.90698 WP_001050913.1.9071 WP_001050913.1.90717 WP_001050913.1.90726 WP_001050913.1.90728 WP_001050913.1.90738 WP_001050913.1.9074 WP_001050913.1.90740 WP_001050913.1.90745 WP_001050913.1.90757 WP_001050913.1.9076 WP_001050913.1.90777 WP_001050913.1.90801 WP_001050913.1.90804 WP_001050913.1.90818 WP_001050913.1.90820 WP_001050913.1.90861 WP_001050913.1.90875 WP_001050913.1.90887 WP_001050913.1.90903 WP_001050913.1.90923 WP_001050913.1.90928 WP_001050913.1.90994 WP_001050913.1.9100 WP_001050913.1.91005 WP_001050913.1.91011 WP_001050913.1.91019 WP_001050913.1.91054 WP_001050913.1.91087 WP_001050913.1.91089 WP_001050913.1.91124 WP_001050913.1.91150 WP_001050913.1.91158 WP_001050913.1.91177 WP_001050913.1.91184 WP_001050913.1.9122 WP_001050913.1.91233 WP_001050913.1.91246 WP_001050913.1.91252 WP_001050913.1.91258 WP_001050913.1.9127 WP_001050913.1.91279 WP_001050913.1.91280 WP_001050913.1.9130 WP_001050913.1.91300 WP_001050913.1.91310 WP_001050913.1.91316 WP_001050913.1.91332 WP_001050913.1.91346 WP_001050913.1.91357 WP_001050913.1.91364 WP_001050913.1.91365 WP_001050913.1.91371 WP_001050913.1.91380 WP_001050913.1.91382 WP_001050913.1.9140 WP_001050913.1.91420 WP_001050913.1.91427 WP_001050913.1.91447 WP_001050913.1.91465 WP_001050913.1.91486 WP_001050913.1.91487 WP_001050913.1.91500 WP_001050913.1.91501 WP_001050913.1.91525 WP_001050913.1.9153 WP_001050913.1.91530 WP_001050913.1.91542 WP_001050913.1.91547 WP_001050913.1.9155 WP_001050913.1.91559 WP_001050913.1.91573 WP_001050913.1.91581 WP_001050913.1.91586 WP_001050913.1.91587 WP_001050913.1.91591 WP_001050913.1.91611 WP_001050913.1.91624 WP_001050913.1.91629 WP_001050913.1.91634 WP_001050913.1.91635 WP_001050913.1.91639 WP_001050913.1.91660 WP_001050913.1.91670 WP_001050913.1.917 WP_001050913.1.91704 WP_001050913.1.91745 WP_001050913.1.91746 WP_001050913.1.91749 WP_001050913.1.91771 WP_001050913.1.91781 WP_001050913.1.91791 WP_001050913.1.91800 WP_001050913.1.91816 WP_001050913.1.91829 WP_001050913.1.91848 WP_001050913.1.91895 WP_001050913.1.91909 WP_001050913.1.91911 WP_001050913.1.91918 WP_001050913.1.91919 WP_001050913.1.91928 WP_001050913.1.91950 WP_001050913.1.91955 WP_001050913.1.92 WP_001050913.1.92055 WP_001050913.1.92057 WP_001050913.1.92080 WP_001050913.1.92104 WP_001050913.1.92110 WP_001050913.1.92115 WP_001050913.1.92125 WP_001050913.1.92133 WP_001050913.1.92140 WP_001050913.1.92143 WP_001050913.1.92147 WP_001050913.1.92158 WP_001050913.1.92164 WP_001050913.1.92169 WP_001050913.1.92173 WP_001050913.1.92185 WP_001050913.1.92186 WP_001050913.1.92196 WP_001050913.1.92212 WP_001050913.1.92218 WP_001050913.1.92228 WP_001050913.1.9224 WP_001050913.1.92244 WP_001050913.1.92249 WP_001050913.1.92253 WP_001050913.1.92254 WP_001050913.1.92259 WP_001050913.1.92278 WP_001050913.1.92297 WP_001050913.1.923 WP_001050913.1.92303 WP_001050913.1.92324 WP_001050913.1.9234 WP_001050913.1.92340 WP_001050913.1.9237 WP_001050913.1.9239 WP_001050913.1.92391 WP_001050913.1.92398 WP_001050913.1.92415 WP_001050913.1.92424 WP_001050913.1.92425 WP_001050913.1.92436 WP_001050913.1.92442 WP_001050913.1.9247 WP_001050913.1.92479 WP_001050913.1.92488 WP_001050913.1.92497 WP_001050913.1.92500 WP_001050913.1.92512 WP_001050913.1.92520 WP_001050913.1.92534 WP_001050913.1.92541 WP_001050913.1.92546 WP_001050913.1.92560 WP_001050913.1.92565 WP_001050913.1.92602 WP_001050913.1.92607 WP_001050913.1.92667 WP_001050913.1.92674 WP_001050913.1.92679 WP_001050913.1.92688 WP_001050913.1.92691 WP_001050913.1.92718 WP_001050913.1.92723 WP_001050913.1.92726 WP_001050913.1.92735 WP_001050913.1.92741 WP_001050913.1.92765 WP_001050913.1.92772 WP_001050913.1.92773 WP_001050913.1.92778 WP_001050913.1.92789 WP_001050913.1.92795 WP_001050913.1.92805 WP_001050913.1.92840 WP_001050913.1.92848 WP_001050913.1.92849 WP_001050913.1.9286 WP_001050913.1.92862 WP_001050913.1.92864 WP_001050913.1.92897 WP_001050913.1.92918 WP_001050913.1.9293 WP_001050913.1.92937 WP_001050913.1.92950 WP_001050913.1.9296 WP_001050913.1.92960 WP_001050913.1.92965 WP_001050913.1.9298 WP_001050913.1.92997 WP_001050913.1.93010 WP_001050913.1.93047 WP_001050913.1.9305 WP_001050913.1.93068 WP_001050913.1.93071 WP_001050913.1.93074 WP_001050913.1.93078 WP_001050913.1.93141 WP_001050913.1.93147 WP_001050913.1.93163 WP_001050913.1.93176 WP_001050913.1.93186 WP_001050913.1.93191 WP_001050913.1.93197 WP_001050913.1.93198 WP_001050913.1.93207 WP_001050913.1.93211 WP_001050913.1.93224 WP_001050913.1.93231 WP_001050913.1.93235 WP_001050913.1.93237 WP_001050913.1.93243 WP_001050913.1.93251 WP_001050913.1.93254 WP_001050913.1.93260 WP_001050913.1.93263 WP_001050913.1.93272 WP_001050913.1.93296 WP_001050913.1.9330 WP_001050913.1.93300 WP_001050913.1.93310 WP_001050913.1.93316 WP_001050913.1.93329 WP_001050913.1.93354 WP_001050913.1.93374 WP_001050913.1.93378 WP_001050913.1.93416 WP_001050913.1.93435 WP_001050913.1.93444 WP_001050913.1.9346 WP_001050913.1.93471 WP_001050913.1.93492 WP_001050913.1.93514 WP_001050913.1.9352 WP_001050913.1.93538 WP_001050913.1.9354 WP_001050913.1.93561 WP_001050913.1.93579 WP_001050913.1.9358 WP_001050913.1.93590 WP_001050913.1.93613 WP_001050913.1.93647 WP_001050913.1.93658 WP_001050913.1.93669 WP_001050913.1.93678 WP_001050913.1.93690 WP_001050913.1.93708 WP_001050913.1.93710 WP_001050913.1.93722 WP_001050913.1.93736 WP_001050913.1.93738 WP_001050913.1.93758 WP_001050913.1.93762 WP_001050913.1.93769 WP_001050913.1.93787 WP_001050913.1.93862 WP_001050913.1.9387 WP_001050913.1.93882 WP_001050913.1.93883 WP_001050913.1.93890 WP_001050913.1.93891 WP_001050913.1.93934 WP_001050913.1.93972 WP_001050913.1.93975 WP_001050913.1.93976 WP_001050913.1.9398 WP_001050913.1.93981 WP_001050913.1.94 WP_001050913.1.94009 WP_001050913.1.94016 WP_001050913.1.94053 WP_001050913.1.94060 WP_001050913.1.94074 WP_001050913.1.9408 WP_001050913.1.94080 WP_001050913.1.94082 WP_001050913.1.94087 WP_001050913.1.94093 WP_001050913.1.94096 WP_001050913.1.9411 WP_001050913.1.94114 WP_001050913.1.94119 WP_001050913.1.94122 WP_001050913.1.94123 WP_001050913.1.94130 WP_001050913.1.94165 WP_001050913.1.94172 WP_001050913.1.94182 WP_001050913.1.94209 WP_001050913.1.94229 WP_001050913.1.94242 WP_001050913.1.94245 WP_001050913.1.94248 WP_001050913.1.94268 WP_001050913.1.94287 WP_001050913.1.94293 WP_001050913.1.94294 WP_001050913.1.9430 WP_001050913.1.94319 WP_001050913.1.94320 WP_001050913.1.94325 WP_001050913.1.94335 WP_001050913.1.94337 WP_001050913.1.94340 WP_001050913.1.94341 WP_001050913.1.94345 WP_001050913.1.9435 WP_001050913.1.9437 WP_001050913.1.94374 WP_001050913.1.94375 WP_001050913.1.94376 WP_001050913.1.94389 WP_001050913.1.94407 WP_001050913.1.94409 WP_001050913.1.94414 WP_001050913.1.94423 WP_001050913.1.94484 WP_001050913.1.94505 WP_001050913.1.94530 WP_001050913.1.94536 WP_001050913.1.94549 WP_001050913.1.9455 WP_001050913.1.94550 WP_001050913.1.94576 WP_001050913.1.94625 WP_001050913.1.94636 WP_001050913.1.9464 WP_001050913.1.94641 WP_001050913.1.94684 WP_001050913.1.94688 WP_001050913.1.947 WP_001050913.1.94719 WP_001050913.1.94733 WP_001050913.1.94741 WP_001050913.1.94789 WP_001050913.1.94797 WP_001050913.1.94825 WP_001050913.1.94838 WP_001050913.1.94844 WP_001050913.1.94845 WP_001050913.1.9485 WP_001050913.1.94857 WP_001050913.1.94866 WP_001050913.1.94941 WP_001050913.1.9495 WP_001050913.1.94958 WP_001050913.1.94969 WP_001050913.1.9497 WP_001050913.1.94980 WP_001050913.1.94989 WP_001050913.1.94992 WP_001050913.1.94999 WP_001050913.1.95002 WP_001050913.1.95014 WP_001050913.1.95023 WP_001050913.1.95029 WP_001050913.1.95033 WP_001050913.1.95038 WP_001050913.1.95049 WP_001050913.1.95075 WP_001050913.1.95077 WP_001050913.1.95090 WP_001050913.1.9510 WP_001050913.1.95120 WP_001050913.1.95154 WP_001050913.1.95156 WP_001050913.1.95174 WP_001050913.1.95193 WP_001050913.1.95210 WP_001050913.1.95263 WP_001050913.1.95294 WP_001050913.1.95304 WP_001050913.1.95307 WP_001050913.1.95318 WP_001050913.1.95327 WP_001050913.1.95342 WP_001050913.1.95361 WP_001050913.1.95372 WP_001050913.1.9538 WP_001050913.1.95386 WP_001050913.1.95409 WP_001050913.1.95415 WP_001050913.1.9544 WP_001050913.1.95442 WP_001050913.1.95452 WP_001050913.1.95476 WP_001050913.1.95494 WP_001050913.1.95500 WP_001050913.1.95505 WP_001050913.1.95512 WP_001050913.1.95519 WP_001050913.1.95522 WP_001050913.1.95535 WP_001050913.1.95537 WP_001050913.1.95545 WP_001050913.1.95550 WP_001050913.1.95552 WP_001050913.1.95560 WP_001050913.1.9557 WP_001050913.1.95571 WP_001050913.1.95581 WP_001050913.1.95603 WP_001050913.1.95631 WP_001050913.1.95640 WP_001050913.1.95681 WP_001050913.1.95683 WP_001050913.1.95699 WP_001050913.1.95713 WP_001050913.1.95714 WP_001050913.1.95737 WP_001050913.1.95760 WP_001050913.1.95780 WP_001050913.1.95781 WP_001050913.1.95804 WP_001050913.1.95806 WP_001050913.1.95832 WP_001050913.1.95877 WP_001050913.1.95885 WP_001050913.1.959 WP_001050913.1.95914 WP_001050913.1.95918 WP_001050913.1.95947 WP_001050913.1.95954 WP_001050913.1.95962 WP_001050913.1.95983 WP_001050913.1.95986 WP_001050913.1.95997 WP_001050913.1.96014 WP_001050913.1.96022 WP_001050913.1.96030 WP_001050913.1.96056 WP_001050913.1.96057 WP_001050913.1.96067 WP_001050913.1.96075 WP_001050913.1.96105 WP_001050913.1.96133 WP_001050913.1.96135 WP_001050913.1.96148 WP_001050913.1.96160 WP_001050913.1.96163 WP_001050913.1.96165 WP_001050913.1.9617 WP_001050913.1.96200 WP_001050913.1.96209 WP_001050913.1.96218 WP_001050913.1.96221 WP_001050913.1.96255 WP_001050913.1.96261 WP_001050913.1.96271 WP_001050913.1.96280 WP_001050913.1.96283 WP_001050913.1.96297 WP_001050913.1.96301 WP_001050913.1.96312 WP_001050913.1.96314 WP_001050913.1.96316 WP_001050913.1.96322 WP_001050913.1.96362 WP_001050913.1.96364 WP_001050913.1.96424 WP_001050913.1.96433 WP_001050913.1.96468 WP_001050913.1.96472 WP_001050913.1.96474 WP_001050913.1.96477 WP_001050913.1.96489 WP_001050913.1.96495 WP_001050913.1.9650 WP_001050913.1.96509 WP_001050913.1.96535 WP_001050913.1.96538 WP_001050913.1.96548 WP_001050913.1.96550 WP_001050913.1.96554 WP_001050913.1.96568 WP_001050913.1.96577 WP_001050913.1.96578 WP_001050913.1.96591 WP_001050913.1.96603 WP_001050913.1.96613 WP_001050913.1.96628 WP_001050913.1.96637 WP_001050913.1.96638 WP_001050913.1.96646 WP_001050913.1.96654 WP_001050913.1.96663 WP_001050913.1.96678 WP_001050913.1.96682 WP_001050913.1.96699 WP_001050913.1.96705 WP_001050913.1.96718 WP_001050913.1.96727 WP_001050913.1.9675 WP_001050913.1.96770 WP_001050913.1.96780 WP_001050913.1.96804 WP_001050913.1.96836 WP_001050913.1.9684 WP_001050913.1.96854 WP_001050913.1.96855 WP_001050913.1.96856 WP_001050913.1.96859 WP_001050913.1.96866 WP_001050913.1.96882 WP_001050913.1.96892 WP_001050913.1.96895 WP_001050913.1.96918 WP_001050913.1.96922 WP_001050913.1.96928 WP_001050913.1.9695 WP_001050913.1.96956 WP_001050913.1.96965 WP_001050913.1.96969 WP_001050913.1.96970 WP_001050913.1.96976 WP_001050913.1.96985 WP_001050913.1.96997 WP_001050913.1.97000 WP_001050913.1.97001 WP_001050913.1.97004 WP_001050913.1.97007 WP_001050913.1.97014 WP_001050913.1.97017 WP_001050913.1.97019 WP_001050913.1.97029 WP_001050913.1.97033 WP_001050913.1.97034 WP_001050913.1.97072 WP_001050913.1.97077 WP_001050913.1.97117 WP_001050913.1.97138 WP_001050913.1.97139 WP_001050913.1.97141 WP_001050913.1.97146 WP_001050913.1.97151 WP_001050913.1.97161 WP_001050913.1.97164 WP_001050913.1.97191 WP_001050913.1.97205 WP_001050913.1.97206 WP_001050913.1.97228 WP_001050913.1.97230 WP_001050913.1.97234 WP_001050913.1.97241 WP_001050913.1.97256 WP_001050913.1.97267 WP_001050913.1.97276 WP_001050913.1.97293 WP_001050913.1.97302 WP_001050913.1.97311 WP_001050913.1.97312 WP_001050913.1.97336 WP_001050913.1.97348 WP_001050913.1.97352 WP_001050913.1.97355 WP_001050913.1.97367 WP_001050913.1.9737 WP_001050913.1.97392 WP_001050913.1.97399 WP_001050913.1.97409 WP_001050913.1.97411 WP_001050913.1.97427 WP_001050913.1.9743 WP_001050913.1.97444 WP_001050913.1.97450 WP_001050913.1.97456 WP_001050913.1.97460 WP_001050913.1.97466 WP_001050913.1.97468 WP_001050913.1.9748 WP_001050913.1.97484 WP_001050913.1.97494 WP_001050913.1.97530 WP_001050913.1.97531 WP_001050913.1.97536 WP_001050913.1.97574 WP_001050913.1.97575 WP_001050913.1.97576 WP_001050913.1.9758 WP_001050913.1.97585 WP_001050913.1.97627 WP_001050913.1.97641 WP_001050913.1.97687 WP_001050913.1.97688 WP_001050913.1.97696 WP_001050913.1.97699 WP_001050913.1.97706 WP_001050913.1.97717 WP_001050913.1.97720 WP_001050913.1.97729 WP_001050913.1.97731 WP_001050913.1.97739 WP_001050913.1.97742 WP_001050913.1.97744 WP_001050913.1.97746 WP_001050913.1.97758 WP_001050913.1.97762 WP_001050913.1.97763 WP_001050913.1.97776 WP_001050913.1.97786 WP_001050913.1.97827 WP_001050913.1.97835 WP_001050913.1.9788 WP_001050913.1.9789 WP_001050913.1.97898 WP_001050913.1.97899 WP_001050913.1.97935 WP_001050913.1.97953 WP_001050913.1.97955 WP_001050913.1.97967 WP_001050913.1.97974 WP_001050913.1.97997 WP_001050913.1.98008 WP_001050913.1.98011 WP_001050913.1.98033 WP_001050913.1.98051 WP_001050913.1.98054 WP_001050913.1.98058 WP_001050913.1.98077 WP_001050913.1.98131 WP_001050913.1.98161 WP_001050913.1.98174 WP_001050913.1.98179 WP_001050913.1.98191 WP_001050913.1.98195 WP_001050913.1.98233 WP_001050913.1.98242 WP_001050913.1.98248 WP_001050913.1.98249 WP_001050913.1.98281 WP_001050913.1.98295 WP_001050913.1.98307 WP_001050913.1.98322 WP_001050913.1.98328 WP_001050913.1.98352 WP_001050913.1.98353 WP_001050913.1.98359 WP_001050913.1.98360 WP_001050913.1.98361 WP_001050913.1.98366 WP_001050913.1.98372 WP_001050913.1.98379 WP_001050913.1.98387 WP_001050913.1.98394 WP_001050913.1.98409 WP_001050913.1.98411 WP_001050913.1.98415 WP_001050913.1.98419 WP_001050913.1.98425 WP_001050913.1.98456 WP_001050913.1.98501 WP_001050913.1.98506 WP_001050913.1.98510 WP_001050913.1.98548 WP_001050913.1.98552 WP_001050913.1.98559 WP_001050913.1.98585 WP_001050913.1.98586 WP_001050913.1.986 WP_001050913.1.98609 WP_001050913.1.98655 WP_001050913.1.98659 WP_001050913.1.98667 WP_001050913.1.98703 WP_001050913.1.98706 WP_001050913.1.98710 WP_001050913.1.9872 WP_001050913.1.98723 WP_001050913.1.98730 WP_001050913.1.98734 WP_001050913.1.98767 WP_001050913.1.98786 WP_001050913.1.98805 WP_001050913.1.98821 WP_001050913.1.98825 WP_001050913.1.98837 WP_001050913.1.98842 WP_001050913.1.98858 WP_001050913.1.98865 WP_001050913.1.98874 WP_001050913.1.98880 WP_001050913.1.98883 WP_001050913.1.98894 WP_001050913.1.98912 WP_001050913.1.98924 WP_001050913.1.98967 WP_001050913.1.98978 WP_001050913.1.98981 WP_001050913.1.98985 WP_001050913.1.99009 WP_001050913.1.99025 WP_001050913.1.99027 WP_001050913.1.9903 WP_001050913.1.99081 WP_001050913.1.99090 WP_001050913.1.991 WP_001050913.1.9910 WP_001050913.1.9912 WP_001050913.1.99136 WP_001050913.1.99155 WP_001050913.1.99171 WP_001050913.1.99174 WP_001050913.1.99183 WP_001050913.1.99195 WP_001050913.1.99207 WP_001050913.1.99217 WP_001050913.1.99228 WP_001050913.1.99237 WP_001050913.1.99249 WP_001050913.1.99262 WP_001050913.1.99280 WP_001050913.1.99283 WP_001050913.1.99308 WP_001050913.1.99311 WP_001050913.1.99331 WP_001050913.1.99359 WP_001050913.1.9936 WP_001050913.1.99394 WP_001050913.1.99405 WP_001050913.1.99414 WP_001050913.1.99418 WP_001050913.1.99430 WP_001050913.1.99492 WP_001050913.1.99494 WP_001050913.1.99509 WP_001050913.1.99519 WP_001050913.1.99523 WP_001050913.1.99524 WP_001050913.1.99525 WP_001050913.1.99536 WP_001050913.1.99564 WP_001050913.1.99569 WP_001050913.1.9960 WP_001050913.1.99631 WP_001050913.1.99638 WP_001050913.1.9965 WP_001050913.1.99686 WP_001050913.1.99688 WP_001050913.1.99700 WP_001050913.1.99714 WP_001050913.1.9974 WP_001050913.1.99768 WP_001050913.1.99777 WP_001050913.1.99802 WP_001050913.1.99830 WP_001050913.1.99849 WP_001050913.1.9985 WP_001050913.1.99850 WP_001050913.1.99859 WP_001050913.1.99860 WP_001050913.1.99862 WP_001050913.1.9987 WP_001050913.1.99884 WP_001050913.1.99888 WP_001050913.1.99901 WP_001050913.1.99926 WP_001050913.1.99934 WP_001050913.1.99950 WP_001050913.1.99954 WP_001050913.1.99955 WP_001050913.1.99963 WP_001050913.1.99979 WP_001050913.1.99984 WP_001050913.1.99985 WP_001050913.1.99999 YP_499796.1.76163 gi|470224638|ref|YP_007623217.1| gi|545637627|ref|YP_008587803.1| gi|470218850|ref|YP_007619244.1| gi|156979607|ref|YP_001441866.1| gi|387602563|ref|YP_005734084.1| gi|151221407|ref|YP_001332229.1| gi|545634700|ref|YP_008585270.1| gi|387150429|ref|YP_005741993.1| gi|88194996|ref|YP_499796.1| gi|161509452|ref|YP_001575111.1| gi|514066142|ref|YP_008128062.1| gi|387780394|ref|YP_005755192.1| gi|15926869|ref|NP_374402.1| gi|15924276|ref|NP_371810.1| gi|479329200|ref|YP_007868259.1| gi|379020997|ref|YP_005297659.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]