SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273036.SAB1358c from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273036.SAB1358c
Domain Number 1 Region: 3-290
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 2.21e-63
Family Lambda integrase-like, catalytic core 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 273036.SAB1358c
Sequence length 295
Comment (Staphylococcus aureus RF122)
Sequence
METIIEEYLRFIQIEKGLSSNTIGAYRRDLKKYQDYMTEHHISHIDFIDRQLIQECLGHL
IDQGQSAKSIARFISTIRSFHQFAIREKYAAKDPTVLLDSPKYDKKLPDVLNVDEVLALL
ETLDLNKINGYRDRTMLELLYATGMRVSELIHLELENVNLIMGFVRVFGKGDKERIVPLG
DAVIEYLTTYIETIRPQLLKKTVTEVLFLNMHGKPLSRQAIWKMIKQNGVKANIKKTLTP
HTLRHSFATHLLENGADLRAVQEMLGHSDISTTQLYTHVSKSQIRKMYNQFHPRA
Download sequence
Identical sequences gi|82751090|ref|YP_416831.1| 273036.SAB1358c WP_000447727.1.102064 WP_000447727.1.13381 WP_000447727.1.13787 WP_000447727.1.14281 WP_000447727.1.18205 WP_000447727.1.26555 WP_000447727.1.26713 WP_000447727.1.28426 WP_000447727.1.32215 WP_000447727.1.34249 WP_000447727.1.3784 WP_000447727.1.3850 WP_000447727.1.39020 WP_000447727.1.41098 WP_000447727.1.43225 WP_000447727.1.4380 WP_000447727.1.45586 WP_000447727.1.49152 WP_000447727.1.52464 WP_000447727.1.55353 WP_000447727.1.63878 WP_000447727.1.66056 WP_000447727.1.67384 WP_000447727.1.74088 WP_000447727.1.92778 WP_000447727.1.93310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]