SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273036.SAB1925c from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273036.SAB1925c
Domain Number 1 Region: 29-338
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.88e-105
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000614
Further Details:      
 
Domain Number 2 Region: 340-490
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-28
Family Glycosyl hydrolases family 32 C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 273036.SAB1925c
Sequence length 494
Comment (Staphylococcus aureus RF122)
Sequence
MTEWTREERYQRIEDVDTEYFKTLKQQVDQSKFRQQFHIQPETGLLNDPNGLIFYKGKYY
VSHQWFPLGAVHGLKYWYNYTSDDLINFKAEGPILNPDTKYDSHGVYSGSAFEYNGHLYY
MYTGNHRDNHWQRHASQMIARLKEDGSVEKFPKPVISQQPEGYTSHFRDPKVFKYGEKYY
AIIGAQNNNQQGRLLLYNTEDIINWHYLGEINTELDDFGYMWECPDYFNVDNQDVILICP
QGIEPKGDQFKNIYQSGYILGKFDIEKLTYEHENFVELDNGFDFYAPQTFLDEKGRRVLI
GWMGLPEIEYPTDNEGWAHCLTIPRVLNVENGQLKQRPYPALEKLRHNKETALGYANKFT
RKLHPYEGKQYELIIDILDNDATEVYFELRTSKTSSTLIAYNKRENKITLDRSDSGLLPT
NDEGTTRSTILDTPLKQLQIFVDTSSIEIFCNDGERVLTSRIFPTEDALGIKTSTESGQV
YLQFTKYDLKDEHK
Download sequence
Identical sequences 273036.SAB1925c WP_000141425.1.13381 WP_000141425.1.14281 WP_000141425.1.18205 WP_000141425.1.26555 WP_000141425.1.26713 WP_000141425.1.28426 WP_000141425.1.32215 WP_000141425.1.34249 WP_000141425.1.3784 WP_000141425.1.3850 WP_000141425.1.39020 WP_000141425.1.41098 WP_000141425.1.43225 WP_000141425.1.4380 WP_000141425.1.45586 WP_000141425.1.49152 WP_000141425.1.52464 WP_000141425.1.54728 WP_000141425.1.63878 WP_000141425.1.67384 WP_000141425.1.74088 WP_000141425.1.93310 gi|82751643|ref|YP_417384.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]