SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273036.SAB2380c from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273036.SAB2380c
Domain Number 1 Region: 4-121
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.43e-24
Family DNA-binding N-terminal domain of transcription activators 0.0054
Further Details:      
 
Weak hits

Sequence:  273036.SAB2380c
Domain Number - Region: 181-237
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0213
Family Di-heme elbow motif 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 273036.SAB2380c
Sequence length 254
Comment (Staphylococcus aureus RF122)
Sequence
MSNYSTGELAKLCNVTTRTIQYYDRKGILKPQGFTEGKRRVYTEQQRQTLELILLLKDLG
CALSDIDMLLKGEGTLKTLNTLLTMKPQEINQQVKQQQAVLNKIKNVQYYVNETSTSPIT
HLKDIEHVMSKSAEMKSIRRNIWISAGIIGIIQYSSIISAILMKNKWPFLIALPFMIGYG
IGVTFYYQQKVAYLCPNCQHIFSPSLWAVIKAKHTATTRRFECPNCHETHYCIEVPKAHM
STEQLEISHIQHNN
Download sequence
Identical sequences 273036.SAB2380c gi|82752089|ref|YP_417830.1| WP_000073999.1.102064 WP_000073999.1.13381 WP_000073999.1.13787 WP_000073999.1.14281 WP_000073999.1.18205 WP_000073999.1.26555 WP_000073999.1.26713 WP_000073999.1.28426 WP_000073999.1.32215 WP_000073999.1.34249 WP_000073999.1.3784 WP_000073999.1.3850 WP_000073999.1.39020 WP_000073999.1.41098 WP_000073999.1.43225 WP_000073999.1.4380 WP_000073999.1.45586 WP_000073999.1.49152 WP_000073999.1.52464 WP_000073999.1.55353 WP_000073999.1.63878 WP_000073999.1.66056 WP_000073999.1.67384 WP_000073999.1.74088 WP_000073999.1.92778 WP_000073999.1.93310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]