SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273063.ST0337 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273063.ST0337
Domain Number 1 Region: 22-105
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000252
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273063.ST0337
Sequence length 109
Comment (Sulfolobus tokodaii)
Sequence
MVFGIERIKYLEENWKNIALLVLNSARNLVDVKEAIVYGSVIKGRTMGSSDLDIALVIRN
LDAKKLSELLIKIHLSLPEDISELVDLNLIDEKDEKEFLKFAGYYIILK
Download sequence
Identical sequences Q975T5
WP_010978297.1.60790 273063.ST0337 gi|15920536|ref|NP_376205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]