SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273063.ST0848 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273063.ST0848
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily PIN domain-like 0.0000239
Family PIN domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 273063.ST0848
Sequence length 167
Comment (Sulfolobus tokodaii)
Sequence
MDTSFLIDWVKYDKRDLLFDYYTTVFLSESVLNEIRTETPLLWISEWLAKGRIKILEETV
DVRRKALLVVDMTRETPLRSADYPEAVCLVLGKELNLDVLTENGGVFAAKEIIEEYNSVN
VYRGIDILYILSQKGLISDFINEVKKYINSTKHTYSKEIREKYGIEI
Download sequence
Identical sequences gi|15921083|ref|NP_376752.1| 273063.ST0848 WP_010978844.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]