SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273063.ST1713 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273063.ST1713
Domain Number 1 Region: 2-128
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.7e-22
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273063.ST1713
Sequence length 163
Comment (Sulfolobus tokodaii)
Sequence
MIKEPYVTLLNNIVRIMREEFKDDLISIVLYGSVARGDNRNDSDVDLLIVMNNLPKDSML
KRIRLFETRVEDKLNLDEYWNKGYYISLSPILKTPDEAEKISPLYLDMVYDAVILYDKDQ
FFTKILEKLKEKLRELGAERIIMGKKWYWILKKDSKFGETVEL
Download sequence
Identical sequences Q96ZX8
WP_010979773.1.60790 gi|15922017|ref|NP_377686.1| 273063.ST1713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]