SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273063.STS077 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273063.STS077
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily Chromo domain-like 1.51e-34
Family "Histone-like" proteins from archaea 0.0000415
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273063.STS077
Sequence length 64
Comment (Sulfolobus tokodaii)
Sequence
MVTVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDDNGKTGRGAVSEKDAPKELLQMLEK
SGKK
Download sequence
Identical sequences Q96X56
273063.STS077 273063.STS226 gi|15920860|ref|NP_376529.1| gi|15922421|ref|NP_378090.1| WP_010978621.1.60790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]