SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273068.TTE1572 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273068.TTE1572
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily DnaK suppressor protein DksA, alpha-hairpin domain 3.79e-18
Family DnaK suppressor protein DksA, alpha-hairpin domain 0.0036
Further Details:      
 
Domain Number 2 Region: 91-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000157
Family Prokaryotic DksA/TraR C4-type zinc finger 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273068.TTE1572
Sequence length 206
Comment (Thermoanaerobacter tengcongensis)
Sequence
MDNEKLMHFKNLLLKEKNKVLSTIHRMNLNDGIGGIAQREYYQELSLLDNHPADMASEVY
EVEKNYALKDNEKNILRQIEDALQKIENGNYGICENCGQPIEEERLEAIPYTTLCSSCAK
EKDLSLKDLKNSRPNEEKVIKYPFGWGYKDKKGEIQFDAEDTFQEVARFNKTRSGSDHYE
EVYDEENAGYVEETDKISNEDYKKTL
Download sequence
Identical sequences A0A124FCK6 Q8R9N4
WP_011025809.1.99938 273068.TTE1572 gi|20808001|ref|NP_623172.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]