SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273116.TVN0323 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  273116.TVN0323
Domain Number - Region: 59-84
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0288
Family PHD domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 273116.TVN0323
Sequence length 135
Comment (Thermoplasma volcanium)
Sequence
MRIGGINKITKKGDGKGNNYRFILKNAFPYGMLASQVMYKASWEGLPAIELTRKETRNTS
RMCSVCDTLARIEHGRILKCDSCGIEIDRDVNACINIAFRYRTCLKRSHKGLPGEAVKQS
KDVEQMAGSQISMDI
Download sequence
Identical sequences Q97BX8
TvR41 gi|13541154|ref|NP_110842.1| WP_010916581.1.10044 273116.TVN0323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]