SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273116.TVN1176 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273116.TVN1176
Domain Number 1 Region: 97-179
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000152
Family Eukaryotic type KH-domain (KH-domain type I) 0.00044
Further Details:      
 
Domain Number 2 Region: 14-88
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000443
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 273116.TVN1176
Sequence length 193
Comment (Thermoplasma volcanium)
Sequence
METIVICGEIEMFLEAIRVPKDRIKVVIGKDGEVKKKIEEMGEVKLTIDTAEAEVSIDQL
GDAVKSSIAKNVVQAIGRGFNPGKAMLLFEENMQLVIISLREFAKPGSSKITQIKARVIG
TGGKTRAIIEELTGSYLSVYGDTISIIGDYLAVTYAEEAINMIINGKKHRTVYAFLEKRA
RELKYKRIEESFG
Download sequence
Identical sequences WP_010917434.1.10044 gi|13542007|ref|NP_111695.1| 273116.TVN1176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]