SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273116.TVN1327 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  273116.TVN1327
Domain Number - Region: 35-100
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0837
Family Calcium ATPase, transmembrane domain M 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 273116.TVN1327
Sequence length 111
Comment (Thermoplasma volcanium)
Sequence
MRQIQVIEKEEEEEVTEGKQLTTRQKLEYIFGDFLRGFYLIGCIFFDVLIVGFSLTFIPN
VSIYEDVVYQSIGTNLILIYGLLLIIFTEAILIYYEIVWFKKFFLRKDHYL
Download sequence
Identical sequences Q978R4
273116.TVN1327 WP_010917585.1.10044 gi|13542158|ref|NP_111846.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]