SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273119.UU568 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273119.UU568
Domain Number 1 Region: 5-94
Classification Level Classification E-value
Superfamily Ribosomal protein S16 1.01e-26
Family Ribosomal protein S16 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273119.UU568
Sequence length 101
Comment (Ureaplasma urealyticum)
Sequence
MKILVKIRLTRVGTHKKPFFRIVVMDAKTKANGAYIENLGHYDPVLGQVVLKKEAILAQL
QNGAQPSETVKNILSQEGIWKEFIALKDANKKRKAALSKAK
Download sequence
Identical sequences Q9PPS1
273119.UU568 gi|13358133|ref|NP_078407.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]