SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273121.WS0548 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273121.WS0548
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily Ribosomal protein S16 3.92e-27
Family Ribosomal protein S16 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 273121.WS0548
Sequence length 77
Comment (Wolinella succinogenes)
Sequence
MATVIRLTRLGRKKKPFYRMVVTDSRKRRDGGWVEAIGYYNPLAETPVVKFDAERLKYWV
SVGAKMSDRVATLTASK
Download sequence
Identical sequences Q7MSD9
WP_011138482.1.32730 gi|34556967|ref|NP_906782.1| 273121.WS0548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]