SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273121.WS0899 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273121.WS0899
Domain Number 1 Region: 322-519
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-42
Family Ribonuclease PH domain 1-like 0.0000675
Further Details:      
 
Domain Number 2 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.63e-41
Family Ribonuclease PH domain 1-like 0.00011
Further Details:      
 
Domain Number 3 Region: 482-575
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.11e-23
Family Ribonuclease PH domain 2-like 0.00018
Further Details:      
 
Domain Number 4 Region: 146-259
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.76e-16
Family Ribonuclease PH domain 2-like 0.0042
Further Details:      
 
Domain Number 5 Region: 659-729
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000589
Family Cold shock DNA-binding domain-like 0.0015
Further Details:      
 
Domain Number 6 Region: 587-683
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000278
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 273121.WS0899
Sequence length 736
Comment (Wolinella succinogenes)
Sequence
MNATIKEIALPNKTETFEFGAIAKQANGSVLYRCGKSVLLASVCYESDERVKEDFLPLTV
QYIEKSYAAGKFPGGFIKRESKPGDFETLTSRIIDRSLRPLFPKGYAHPTQITVMVLSAQ
NDADLQTMALNAASAALFVSDIPLRKPVHGLRIGKINGALVVNPTTKEMSESTLDLFVSG
VEEDLLMIEMRTLASDEINNTCFVGDCGMVAASASDILKIHQANEMKEEELLEALELAKT
SIKKASACYVEAFTPLAKPDAILELKPDITSSEIYQYIKENHAIAIKEAITRMAKSERHS
DLKRIAKEIASSERAQESEWSFEAVYETVGKYKREAVRALILEERRRADGRGLKEVRPID
IQTNILPNAHASALFTRGETQALVVATLGGDMDAQSYELLTEKGSSKERFMVHYNFPSFS
VGEAGMVGAPGRRELGHGNLAKRALEPTIEEWGAQTIRLVSEILESNGSSSMATVCGGSL
ALKAAGINTTALVAGVAMGLIVEAEKHAILTDIMGLEDHDGDMDFKIAGTSTGITAMQMD
IKLGGLSMEILKEALYQAKEGREHILGIMEKAQSEIIINDEILPSLQIFSINPGRIVDII
GQAGKTIKEIIERFEVAIDLNRDNGEVKVTGSNKQKVEAAKEHILSISNQEAPQRVRVAD
VYSAGEVFKGKVKKIVDFGAFIELPKGGDGLLHVSKIVQHRDQRIDEVIKEGEEIEVQIL
SINKNKVELGRATRPN
Download sequence
Identical sequences Q7M9I4
gi|34557289|ref|NP_907104.1| 273121.WS0899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]