SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 273123.YPTB2846 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  273123.YPTB2846
Domain Number 1 Region: 99-206
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 2.98e-19
Family Crystallins/Ca-binding development proteins 0.0021
Further Details:      
 
Domain Number 2 Region: 14-108
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00000000000000246
Family Crystallins/Ca-binding development proteins 0.01
Further Details:      
 
Weak hits

Sequence:  273123.YPTB2846
Domain Number - Region: 323-406
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000206
Family Exotoxin A, N-terminal domain 0.019
Further Details:      
 
Domain Number - Region: 696-805
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00121
Family N-acetyl transferase, NAT 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 273123.YPTB2846
Sequence length 806
Comment (Yersinia pseudotuberculosis IP32953)
Sequence
MRYNRNHMLTLMFSLLIFDAYANEPKVCFYMDDDYNGESLCAAQGNSVASIPDKWNDRIS
SISIPHGLVVTVYEDVDFLGASRSFEADVDLVSDKDLIYLNDNISAFKIKKAVCFYGESN
FTGDSLCLSGDEQFDLYSGSYPERKQSHLVNPLNDDVYSIKIPPGMQTTVYEDDNYNGKH
FVLTEDYTSDDLLIIRMNNKISSMRVSQDEDFICDRFCSIKKSIKFKIQKSFGSYWLDPR
IKYRDILVDFQLSDTDDYSIKFFDEGLIKVKDYKLFFFDGNKKYGEGFLFNLDNKSSNLS
FLLRFNGGFFQIQFVESLNNEIVYSSPLIGTLFDDVNSNVIFDINNIDANSPIVIDKMVL
TVGKEHNRAERSTLGLATCWTIPILSIYNYIVQGHCNQADKFVHNAADFFGSPADKILQI
FGSSLPLPKKNSNETLDDESALINFMSDVKGTLTYITTNMGEHALTVPATALACKASMRE
KILPHLRSRRDLAPGCIDWTLSILTDFTLLFGASIEYWNSKNFGRVIENIVREGEIGSAV
ADVETASRLVESVQAHVAEATEVADIIHLKTAFDFSQLSYVNYLRHTEEEVIPPQSAQTL
PLGRYELALVDYHFIETVPRIRQDGRWVERPDLHFDIEVISGVPEETNASRQVLLPIIEA
WQHSYRQQELLFQSSEIPPESALARNEIEPLLEASRLTSEVATSWLRTSRDDFVYVVVRL
EGEVISLTMAVDINTNYVGVAGSLTNPDYVLTPNAEGAVRGAGTAATRALADHFKRKGKI
SLVSSVISQPSAIVKKKVGFRFIEEL
Download sequence
Identical sequences Q667Z4
gi|51597162|ref|YP_071353.1| WP_011192805.1.26383 WP_011192805.1.50185 273123.YPTB2846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]