SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 278197.PEPE_0895 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  278197.PEPE_0895
Domain Number 1 Region: 45-131
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 1.57e-21
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0023
Further Details:      
 
Domain Number 2 Region: 135-190
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 8.76e-19
Family Head domain of nucleotide exchange factor GrpE 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 278197.PEPE_0895
Sequence length 190
Comment (Pediococcus pentosaceus ATCC 25745)
Sequence
MAKEKKEEVKEEEVSEATSTEGSTDVESTNNDDLTTETQATTALDDIKKVEAERDELSDK
YIRAQAEIVNMRRRNEKEQASLIKYDGQKLAKAILPALDNLERALAVESASEQLLKGVKM
VQTDLLKALKENHVAEIEAEGQAFDPNMHQAVQTVPADDDHPADTVVQVLQKGYILKDRV
LRPAMVIVAQ
Download sequence
Identical sequences Q03FR8
278197.PEPE_0895 gi|116492661|ref|YP_804396.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]