SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 278197.PEPE_0988 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  278197.PEPE_0988
Domain Number - Region: 4-59
Classification Level Classification E-value
Superfamily Prefoldin 0.00366
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 278197.PEPE_0988
Sequence length 67
Comment (Pediococcus pentosaceus ATCC 25745)
Sequence
MSKKVKEVIEETKPANNSSEEKISELNNKIAQLERTNQVLSQLSNDRNERISQLEIEVAT
YKTINKN
Download sequence
Identical sequences Q03FH8
278197.PEPE_0988 gi|116492751|ref|YP_804486.1| WP_011673396.1.1876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]