SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 278197.PEPE_1049 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  278197.PEPE_1049
Domain Number 1 Region: 189-313,346-374
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000112
Family Legume lectins 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 278197.PEPE_1049
Sequence length 412
Comment (Pediococcus pentosaceus ATCC 25745)
Sequence
MTAKFGKSFNKKKYCPRLEPKRILTLINLAMLGLGISYLQHADVAQASEIGKVNTYKDAN
SLKTNQLLELTKNGKTTKEVGVDVKTETHSQPSKSNDTNKRADSNQASRLLKKNQNRIVD
PKTIKDDWSLKNTKVKNRALITPKKIHENQGTIKNINFINSEIKVKPNDKTDLQDNVYVN
KDNFKDYFNQNGSAKGNYNPITGEQKLTTGSWQSGNITFKGGIDLRHNFRIDGAINLGKE
TKVRNVFRVLKGIADGIGIVFYKGTRNQIGGSGGNLGIYGVTNAFGWKADTWHNVGRSFK
FGNTTRRLQGEADDAFPDPYGAMVTTNKNGQGTIDKDSVRPLPKIIEDNKYHAIKMIYTA
RTKEFKVILSTPTGDVILRKNLIMMLKIPSITLLSLHPQAYYLLNNFLKLTP
Download sequence
Identical sequences Q03FB7
gi|116492812|ref|YP_804547.1| WP_011673457.1.1876 278197.PEPE_1049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]