SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 279010.BL03022 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  279010.BL03022
Domain Number 1 Region: 25-299
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.21e-79
Family alpha-L-arabinanase-like 0.0000424
Further Details:      
 
Domain Number 2 Region: 331-525
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-38
Family Beta-D-xylosidase C-terminal domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 279010.BL03022
Sequence length 534
Comment (Bacillus licheniformis ATCC 14580)
Sequence
MAKSLTGKAKHHPPVWNPNIDGGRFCNPVLFMDYSDPDVIRKGSDFFMAASSFSCFPGIP
ILHSTDLVNWSLISHVFDELPFGEYEAPAHGKGAWAPSIRYHNGEFWVYFATPDEGIFMS
KTSDPFKGWEPLIQVKKTKGWIDPCPFWDDDGNAYLIHAYANSRIGIKSKLNLCRMKKDG
TALEDDGEIVFDGTLNHPTIEGPKLYKKDGYYYIFAPAGGVKTGWQTVLRSKQIYGPYED
KVVLHQGNTVINGPHQGGWVELDSGESWFIHFQDRGAFGRVVQLQPVRWFDGWPLMGEDI
NGDGIGEPVLHWEKPKTGAKEVKLPFDHGNDDFSSSDRLALHWQWEANPKQEWYSLSASP
GRLRLYSRGIAHPFKLSRLPNLLMQKFSGPSFTATVKLSLNALSETMMAGLAVMGREYAY
LGFSKSENGYRLSVYEGRIEGDQEDVKTEERGVHAEMVYLRVTVDEQAVCRFSCSMDRRH
FTQIGNSFQAVPGLWTGAKAGVYCADTGGEDGQDGWCDIEWFSVEPAGGECHER
Download sequence
Identical sequences A0A1Y0XSS1 Q65MB7 T5HX68
gi|404488162|ref|YP_006712268.1| 279010.BL03022 gi|52079295|ref|YP_078086.1| WP_003179886.1.10695 WP_003179886.1.12567 WP_003179886.1.1290 WP_003179886.1.21456 WP_003179886.1.22930 WP_003179886.1.27603 WP_003179886.1.30581 WP_003179886.1.31090 WP_003179886.1.31877 WP_003179886.1.34863 WP_003179886.1.35764 WP_003179886.1.46635 WP_003179886.1.47006 WP_003179886.1.48016 WP_003179886.1.50447 WP_003179886.1.55910 WP_003179886.1.57471 WP_003179886.1.62441 WP_003179886.1.719 WP_003179886.1.71919 WP_003179886.1.74244 WP_003179886.1.8120 WP_003179886.1.85389 WP_003179886.1.86740 WP_003179886.1.94809 WP_003179886.1.9500 WP_003179886.1.95031 WP_003179886.1.96953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]