SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 279010.BL03023 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  279010.BL03023
Domain Number 1 Region: 7-311
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 2.36e-93
Family alpha-L-arabinanase-like 0.000000223
Further Details:      
 
Domain Number 2 Region: 313-512
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.89e-55
Family Beta-D-xylosidase C-terminal domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 279010.BL03023
Sequence length 515
Comment (Bacillus licheniformis ATCC 14580)
Sequence
MSGEHTYTNPVLTGFHPDPSIIRVGEDYYMVNSTFQYFPAIVISHSKDLVHWKIIGHGIT
ENEGLDLSDINDSHGIWAPDISYHNGTFYIFATHRLNGPTVINGRKLIRRQIMIKSSRPE
GPYSKPVFIDEGSGIDPSHFVDGDGKHYMLLSPACTLFPLNEECTDISGEPVQIWEGTGR
RAPEGPHLLKKDGYYYAILAEGGTGYSHSITTARSTHLYGPYEPCPYNPILTQTDPDAPI
QRAGHGKLVETQNGEWWAVYLCGRPNQGSYTTVGRETALDPVEWTDDGWFVINNLKGPSL
VQRAPNLPQVKWDEKNFDDFDEDTLGLDWQFVRNPDHSSWSLIERPGYLRLWTGDWDLHD
IRAKNTVVRREKHHLYSAGVKLDFSPSASGEQAGIVCYYSTNNYLKCCLIYEEGLKIKVV
ENRSGCQKTLGKKHAEAGPLFLKAVINKQKRDFYYSYEGKHWHHAGGTEDASFLSDEGSR
DAKGHTGTMVGIFANNGGSGRKAAADFDWFRYIAY
Download sequence
Identical sequences Q65MB6
WP_011197672.1.1290 WP_011197672.1.74244 279010.BL03023 gi|52079296|ref|YP_078087.1| gi|404488163|ref|YP_006712269.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]