SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 279238.Saro_2470 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  279238.Saro_2470
Domain Number 1 Region: 69-599
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.74e-126
Family Arylsulfatase 0.00000363
Further Details:      
 
Domain Number 2 Region: 636-783
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000769
Family Laminin G-like module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 279238.Saro_2470
Sequence length 786
Comment (Novosphingobium aromaticivorans DSM 12444)
Sequence
MRAIRSALRLSARKRRLCGGSAIAALLAPTFVLAETAPADPLAGKVGRTVQVTHAPAWPA
QPQAPKGAPNVLVILTDDVGFGVTSAFGGPVPTATFDALAQTGLRYNRFNTTALCSPTRA
SLLTGRLPQNVDMGNVTNLPTGFDGYTTVIPQSAATVAEVLKENGFNTAMFGKSHLTPEW
QTSAAGPFDQWPTGLGFEYFYGFLSADTSMWQPSIVENTLPVEPPHDDPNYFFEKDMADH
AIKWMRTQQAAAPDKPFFMYYAPGIAHTPHHAPKEWLEKFRGKFDQGWDKLREETFARQK
RMGIIPANSRLSPRPATLPAWDSLNADQKKLYSRLMEAYAASVSYSDHQTGRLIEAIRET
GELDNTLIIYIQGDNGSSAEGGPEGLLYEQSTITGRKETMAEKLSHIDDIGGPKLYNHFP
AAWAWATNSPFPWWKQVASQAGGVRNGMVVSWPKRITERGVIRSQYAHVSDIAPTVLDAV
GIKSPDLIKGIRQKPVDGISLAYTFQQGSAPSARRMQIYEMMENFGIYKDGWMAGTLPKR
AAWEAGAAGDRKLSVGPDEREWSLFNLDADFTTAKDLAKQNPAKLKEMQDLFWAEAARNN
ILPIHDYSQGTEGRPSLGAYRSSFTYRPGTATIAEDAAPHTIGKSFRIDADVTAGSSTNG
VMIAQGGRFGGYSFYLKDGRPTFHYNAVGADAFTVAAGSALAEGKHTLSAEFTADKTVPG
TPGTLTLYVDGKAVGSSRLGRTVAGWMSHTEGLDVGLDRISAVSPDYSVQDSAFTGEIDE
VRVSIK
Download sequence
Identical sequences Q2G5G7
gi|87200483|ref|YP_497740.1| WP_011446112.1.26809 WP_011446112.1.96002 279238.Saro_2470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]