SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 279808.SH0991 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  279808.SH0991
Domain Number 1 Region: 30-340
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 6.6e-101
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000056
Further Details:      
 
Domain Number 2 Region: 343-492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-29
Family Glycosyl hydrolases family 32 C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 279808.SH0991
Sequence length 494
Comment (Staphylococcus haemolyticus)
Sequence
MAEWSREERYRRIEDVDKKYLENLKQQVKASRFRQIFHIQPETGLLNDPNGLIYHNGKYY
VSHQWFPLGAVHGLKYWFNYTSDDLVAFEPQDTLIKPDTYYDSHGVYSGSAFDHNGDLYY
MYTGNHRDEQWNRYASQMIAKVQSNGEITKFDEPVIPSQPEGYTSHFRDPKVFELNNEYY
AIIGAQTNEELGCCLIYKTNDKQLNQWSYCGEIDTKLKNFGYMWECPDYFKLDSKDILLF
SPQGIEPQGDQFRNIYQSGYLIGDLNFDSLSFDHSEFVELDNGFDFYAPQTFLDENGNRV
LIGWMGLPEINYPTDEEGWAHCLTIPRVLTIENNQLRQRPFKGLERLRKNKETALGYANK
FNRKLHPYEGKQYELIIDIIENDASKIYFELRTSKQNNTKIIYNTREQKITLDRSESGLL
PENVQDLTRSTILDSPLTRLQIFVDTSSIEIFCNDGERVLTSRIFPDENATGIETSTETG
QVYLKFTKYELKDE
Download sequence
Identical sequences Q4L7S5
279808.SH0991 WP_011275299.1.101333 WP_011275299.1.12461 WP_011275299.1.37236 WP_011275299.1.48683 WP_011275299.1.57178 WP_011275299.1.639 WP_011275299.1.67849 WP_011275299.1.68328 WP_011275299.1.75368 WP_011275299.1.76992 WP_011275299.1.79350 WP_011275299.1.8193 WP_011275299.1.82878 WP_011275299.1.84390 WP_011275299.1.84838 gi|70725992|ref|YP_252906.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]