SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281090.Lxx00170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281090.Lxx00170
Domain Number 1 Region: 72-258
Classification Level Classification E-value
Superfamily Rhomboid-like 1.7e-41
Family Rhomboid-like 0.001
Further Details:      
 
Weak hits

Sequence:  281090.Lxx00170
Domain Number - Region: 7-37
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000256
Family B-box zinc-binding domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281090.Lxx00170
Sequence length 285
Comment (Leifsonia xyli xyli CTCB0)
Sequence
MSQPVGAPMSTCYRHPGRVSYVLCQRCERTICGECQTPAAVGVVCPECMAQQRSTAPRTK
PAWLTRVTAPGAPVVTYAIIAVCVVVFLLQNAPIVGGRIESALIYAGGYSHPTGSLSPLI
AFEPWRMLTSLFAHASLIHLALNMYTLWVFGIALEPMLGRLRYAALFLIAGFAGSLAVLL
ITPPGQGVLGASGAIFGMFGAFFIIQRRLGGNATQILTLVAINLAIGFIPGLNISWQAHI
GGFIGGLLLGLIYVETSKPSRRRWQLSLTALLCALLIAVSLLHFF
Download sequence
Identical sequences Q6AHM4
281090.Lxx00170 WP_011185126.1.68452 WP_011185126.1.84704 gi|50953938|ref|YP_061226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]