SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281090.Lxx09030 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281090.Lxx09030
Domain Number 1 Region: 7-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.67e-43
Family Ribonuclease PH domain 1-like 0.000000582
Further Details:      
 
Domain Number 2 Region: 339-510
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.1e-43
Family Ribonuclease PH domain 1-like 0.000000623
Further Details:      
 
Domain Number 3 Region: 492-591
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.57e-22
Family Ribonuclease PH domain 2-like 0.000021
Further Details:      
 
Domain Number 4 Region: 153-272
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.34e-21
Family Ribonuclease PH domain 2-like 0.0000201
Further Details:      
 
Domain Number 5 Region: 596-706
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.79e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 6 Region: 277-363
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000175
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281090.Lxx09030
Sequence length 761
Comment (Leifsonia xyli xyli CTCB0)
Sequence
MEGPEITFAEAMLDNGRFGARTVRFETGRIAQQAQGAVAAYLDEETMLLSATSASKHPKD
NFDFFPLTVDVEERSYAAGKIPGSFFRREGRPSTEAILVCRLIDRPLRPSFVDGLRNEVQ
IVVTVLSIAPDEFYDALAINAASASTQISGLPFSGPIAGVRLALIPGNGAHEDQWVAFPK
ASQLEEAVFDLIVVGRVLTNEDGTEGDVAIMMVEAEATEGSWNLIQGGAVKPNEEVVAQG
LEAAKPFIRQLVGAQAALAKQSAKAIADYPVFLPYSQETYDSVAALAYDELVNVYQIADK
VERQNADDALKERVKAALAEKAQAGALDAEALTQFSAAYKSVSKVVMRGRVLREGVRIDG
RGLTDIRPLDAEVQIIPRVHGSAVFQRGETQILGVTTLNMLKMEQQIDSLSPVTKKRYLH
HYNFPPYSTGETGRVGSPKRREIGHGFLAERALVPVLPSREEFPYAIRQVSEALSSNGST
SMGSVCASTLSLLNAGVPLRAPVAGIAMGLISDVIDGETRYAALTDILGAEDALGDMDFK
VAGTSEFVTAIQLDTKLDGIPSSVLASALKQAKDARTTILSVLDAAIDAPDEMAPTAPRV
ISVQIPVDKIGELIGPKGKTINAIQDETGADISIDEDGTVYIGAVDGPSAEAARAQVNVI
ANPTNPEVGEQFLGTVVKNAAFGAFVSLLPGKDGLLHISEVRKLAGGKRVESVDDVLSIG
QKILVEITKIDDRGKLSLAPVLADEAETHGHDAASEGPTEG
Download sequence
Identical sequences A0A1E2SI34 Q6AFQ2
WP_011185791.1.68452 WP_011185791.1.84704 281090.Lxx09030 gi|50954610|ref|YP_061898.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]