SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281309.BT9727_0667 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281309.BT9727_0667
Domain Number 1 Region: 23-334
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.55e-113
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000382
Further Details:      
 
Domain Number 2 Region: 333-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-25
Family Glycosyl hydrolases family 32 C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281309.BT9727_0667
Sequence length 491
Comment (Bacillus thuringiensis konkukian)
Sequence
MSKYKTILQSNKDELHSLYEIANQDSWKPIYHIHPPFGLMNDPNGVSYYNDEYHVFYQWY
PFGPIHGMKHWGHVKSKDLINWERMPVAIIPTESYESHGAYSGSAIVKDDLLHLLYTGNI
KNPDDSRDAKQCMATMDSQYTMTKYSNNPVIDIIPDGYTKHVRDPKVWKHNDIYYMLLGA
QRKNKTGTLLLYKSKDLYNWNFQGEITTNLKEFGFMWECPDYFQLSGKDVLLFSPQGIEK
DRENFHNIYNVVYAIGHFDIKNLYFHIDSYYEADKGFDFYAPQTLEDSTSRRLLFAWAGS
SEITYPSDDYMWAHCLTLPRELTLEDNILKQKPVSELTKLRTTKKEISGDITAGLNVLST
LDNEGSYELIVTLKTEDAKRFGLSLFHNEEECFPITFNRKEGTVSIDRSNFCHQFGGEYG
YERYKKINIQDTIELQIFVDTSIVEIFLCDGSTVFTSRVFPRKDLKHHIAIFSDAKLNFI
ITQYKLKRGIV
Download sequence
Identical sequences A0A2B6CI89 Q6HN59
WP_000049739.1.43104 YP_035012.1.62562 281309.BT9727_0667 gi|49476899|ref|YP_035012.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]