SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281309.BT9727_1523 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281309.BT9727_1523
Domain Number - Region: 70-156
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.0155
Family Tryptophan biosynthesis enzymes 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281309.BT9727_1523
Sequence length 165
Comment (Bacillus thuringiensis konkukian)
Sequence
MNIFLCGSNQLTALDQEEIKKFLTDYAHKHKIYILCYKSIENEILRFFIENERLAQNLCL
YTLQPLQALTDEFQEVVDYLKKHGAEYVAFDHPSDSIYRSDYMFFVKQIIEDTDLVLCFY
NGDKHTSVIPVDVAKEAGIDAVIYDLPGLHEKQMKKNFEQKIRMM
Download sequence
Identical sequences A0A0B5NDN5 A0A0K6L6W0 A0A2A7DGL8 A0A2A7E6V6 A0A2B4FQZ0 A0A2C5LT13 C2TEL9 C3G154 C3GGW2 Q6HKR6
281309.BT9727_1523 WP_001020094.1.100059 WP_001020094.1.16013 WP_001020094.1.16156 WP_001020094.1.17265 WP_001020094.1.23615 WP_001020094.1.29804 WP_001020094.1.30216 WP_001020094.1.33536 WP_001020094.1.41083 WP_001020094.1.41365 WP_001020094.1.42217 WP_001020094.1.43104 WP_001020094.1.45919 WP_001020094.1.46349 WP_001020094.1.46549 WP_001020094.1.4865 WP_001020094.1.53879 WP_001020094.1.56318 WP_001020094.1.56580 WP_001020094.1.59173 WP_001020094.1.63137 WP_001020094.1.64491 WP_001020094.1.7096 WP_001020094.1.77902 WP_001020094.1.81198 WP_001020094.1.90155 WP_001020094.1.90187 WP_001020094.1.90596 WP_001020094.1.93290 WP_001020094.1.93893 WP_001020094.1.95308 YP_035855.1.62562 gi|49480947|ref|YP_035855.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]