SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281309.BT9727_2931 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281309.BT9727_2931
Domain Number 1 Region: 5-201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-40
Family Beta-D-xylosidase C-terminal domain-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281309.BT9727_2931
Sequence length 209
Comment (Bacillus thuringiensis konkukian)
Sequence
MNNQYKLIEEFNNAEFDKSLKWFSPPKDWEVNSNKSKLIVKPDKETDFWQKTHYEFQVDN
GHFLYYELNGDFRLITKVKSKPANRYDQAGLMVRFSKDTWLKTSVEYIPDDNSKLGVVVT
KNGYSDWSSQEFFGDLNSLYYRITRRGNNYYVDYSLDGDLWKQIRMVYLFEEKDCMKVGI
YACSPQGDGYEAEFEFIKIENIDDNTKVY
Download sequence
Identical sequences Q6HGS2
BuR54 WP_001064873.1.43104 YP_037254.1.62562 281309.BT9727_2931 gi|49478045|ref|YP_037254.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]