SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281309.BT9727_3519 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281309.BT9727_3519
Domain Number 1 Region: 316-467
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.59e-30
Family HD domain 0.01
Further Details:      
 
Domain Number 2 Region: 208-304
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.42e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Weak hits

Sequence:  281309.BT9727_3519
Domain Number - Region: 90-137
Classification Level Classification E-value
Superfamily Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.017
Family Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281309.BT9727_3519
Sequence length 520
Comment (Bacillus thuringiensis konkukian)
Sequence
MSSTVWILISILLATVGAVVGFFVRKSIAEAKINGAANEAKRILDEANREAEALKKEALL
EAKDEIHTLRTEAELEIRDRRSELQKQENRLMQKEENLDRKDETLDKRELQLEKKEDSLV
ARQQQIEELESKVGELVQKQQTELERISNLTREQAKAIILGKVESEVSHEIAVMVKESEV
RAKEEADKKAKEILSLAMQRCAADHVAETTVSVVNLPNDEMKGRIIGREGRNIRTLETLT
GIDLIIDDTPEAVILSGFDPIRRETARIALDKLVQDGRIHPARIEEMVEKSRREVDEYIR
EVGEQTTFEVGVHGLHPDLIKILGRLKYRTSYGQNVLKHSMEVAYLTGLMAAELGEDEKL
ARRAGLLHDIGKAIDHEVEGSHVEIGVELATKYKEHPVVINSIASHHGDTEPTSIIAVLV
AAADALSAARPGARSETLENYIRRLEKLEEISESYEGVEKSFAIQAGREVRILVKPDTID
DLEAHRLARDIRKRIENELDYPGHIKVTVIRETRAVEYAK
Download sequence
Identical sequences A0A0B5TF74 A0A0B6BP11 A0A0G8DGB3 A0A0K6N361 A0A0U0EMW6 A0A154AWA5 A0A158RL46 A0A242W9U1 A0A243BAH5 A0A243CQ08 A0A246UPK9 A0A2B4F1Q2 A0A2B8VDK0 A0RHF0 B3Z5S0 B3ZMT9 C2NLI3 C2QFS2 C2TK99 C2VXI9 C3G6S9 C3GMN3 D8H7X2 Q636P8 Q6HF37 Q81WQ4
gi|49478929|ref|YP_037839.1| 198094.BA_3914 260799.BAS3627 261594.GBAA3914 281309.BT9727_3519 288681.BCZK3537 568206.BAMEG_0717 572264.BCA_3875 592021.BAA_3939 gi|227813314|ref|YP_002813323.1| gi|52141710|ref|YP_085119.1| gi|301055268|ref|YP_003793479.1| gi|386737601|ref|YP_006210782.1| gi|229601444|ref|YP_002868020.1| gi|47529205|ref|YP_020554.1| BuR141 IDP02163 gi|49186628|ref|YP_029880.1| gi|376267671|ref|YP_005120383.1| gi|30263784|ref|NP_846161.1| gi|225865759|ref|YP_002751137.1| NP_846161.1.87267 WP_000099773.1.100059 WP_000099773.1.100214 WP_000099773.1.100409 WP_000099773.1.100595 WP_000099773.1.101931 WP_000099773.1.10208 WP_000099773.1.11387 WP_000099773.1.11427 WP_000099773.1.11676 WP_000099773.1.12289 WP_000099773.1.13115 WP_000099773.1.13221 WP_000099773.1.13233 WP_000099773.1.13820 WP_000099773.1.14721 WP_000099773.1.14855 WP_000099773.1.14882 WP_000099773.1.15163 WP_000099773.1.15460 WP_000099773.1.15569 WP_000099773.1.16013 WP_000099773.1.16156 WP_000099773.1.16170 WP_000099773.1.16997 WP_000099773.1.17146 WP_000099773.1.17424 WP_000099773.1.18976 WP_000099773.1.19258 WP_000099773.1.19435 WP_000099773.1.19445 WP_000099773.1.20390 WP_000099773.1.20665 WP_000099773.1.20680 WP_000099773.1.21021 WP_000099773.1.21258 WP_000099773.1.21776 WP_000099773.1.22865 WP_000099773.1.23269 WP_000099773.1.23615 WP_000099773.1.23873 WP_000099773.1.2419 WP_000099773.1.24334 WP_000099773.1.24338 WP_000099773.1.24556 WP_000099773.1.24608 WP_000099773.1.24676 WP_000099773.1.25316 WP_000099773.1.2569 WP_000099773.1.25716 WP_000099773.1.25752 WP_000099773.1.26000 WP_000099773.1.2618 WP_000099773.1.26450 WP_000099773.1.26665 WP_000099773.1.26721 WP_000099773.1.26847 WP_000099773.1.27644 WP_000099773.1.27987 WP_000099773.1.28427 WP_000099773.1.28729 WP_000099773.1.29101 WP_000099773.1.29451 WP_000099773.1.29766 WP_000099773.1.29787 WP_000099773.1.29804 WP_000099773.1.30110 WP_000099773.1.30216 WP_000099773.1.30336 WP_000099773.1.31490 WP_000099773.1.3236 WP_000099773.1.32576 WP_000099773.1.33175 WP_000099773.1.33338 WP_000099773.1.33367 WP_000099773.1.33536 WP_000099773.1.33740 WP_000099773.1.33828 WP_000099773.1.33876 WP_000099773.1.34158 WP_000099773.1.34646 WP_000099773.1.35684 WP_000099773.1.35886 WP_000099773.1.36305 WP_000099773.1.36763 WP_000099773.1.3699 WP_000099773.1.38036 WP_000099773.1.39781 WP_000099773.1.40550 WP_000099773.1.41165 WP_000099773.1.41365 WP_000099773.1.41675 WP_000099773.1.42217 WP_000099773.1.43104 WP_000099773.1.4439 WP_000099773.1.44483 WP_000099773.1.45305 WP_000099773.1.45385 WP_000099773.1.45533 WP_000099773.1.45919 WP_000099773.1.46236 WP_000099773.1.46476 WP_000099773.1.46549 WP_000099773.1.46699 WP_000099773.1.47145 WP_000099773.1.4763 WP_000099773.1.47644 WP_000099773.1.47798 WP_000099773.1.4865 WP_000099773.1.49831 WP_000099773.1.50350 WP_000099773.1.50416 WP_000099773.1.51167 WP_000099773.1.51749 WP_000099773.1.52794 WP_000099773.1.53137 WP_000099773.1.53493 WP_000099773.1.53683 WP_000099773.1.53879 WP_000099773.1.54117 WP_000099773.1.54189 WP_000099773.1.55811 WP_000099773.1.55958 WP_000099773.1.55968 WP_000099773.1.56042 WP_000099773.1.56176 WP_000099773.1.56270 WP_000099773.1.56318 WP_000099773.1.56580 WP_000099773.1.56959 WP_000099773.1.58160 WP_000099773.1.58335 WP_000099773.1.59095 WP_000099773.1.59173 WP_000099773.1.59310 WP_000099773.1.59575 WP_000099773.1.59978 WP_000099773.1.60402 WP_000099773.1.60841 WP_000099773.1.61213 WP_000099773.1.62300 WP_000099773.1.63137 WP_000099773.1.63560 WP_000099773.1.63611 WP_000099773.1.64491 WP_000099773.1.66331 WP_000099773.1.66357 WP_000099773.1.67239 WP_000099773.1.68607 WP_000099773.1.69203 WP_000099773.1.69323 WP_000099773.1.69822 WP_000099773.1.69894 WP_000099773.1.70065 WP_000099773.1.7096 WP_000099773.1.70996 WP_000099773.1.71895 WP_000099773.1.71953 WP_000099773.1.72704 WP_000099773.1.73325 WP_000099773.1.74226 WP_000099773.1.74337 WP_000099773.1.74538 WP_000099773.1.75499 WP_000099773.1.75870 WP_000099773.1.76125 WP_000099773.1.76783 WP_000099773.1.77668 WP_000099773.1.77824 WP_000099773.1.782 WP_000099773.1.7856 WP_000099773.1.78644 WP_000099773.1.79315 WP_000099773.1.79584 WP_000099773.1.80439 WP_000099773.1.80695 WP_000099773.1.81799 WP_000099773.1.82289 WP_000099773.1.83938 WP_000099773.1.83951 WP_000099773.1.84045 WP_000099773.1.85689 WP_000099773.1.85901 WP_000099773.1.86119 WP_000099773.1.86140 WP_000099773.1.86239 WP_000099773.1.86288 WP_000099773.1.8698 WP_000099773.1.8825 WP_000099773.1.88641 WP_000099773.1.90155 WP_000099773.1.90596 WP_000099773.1.90791 WP_000099773.1.90883 WP_000099773.1.9186 WP_000099773.1.92686 WP_000099773.1.9269 WP_000099773.1.92831 WP_000099773.1.93271 WP_000099773.1.93744 WP_000099773.1.93893 WP_000099773.1.93927 WP_000099773.1.94237 WP_000099773.1.94322 WP_000099773.1.94373 WP_000099773.1.94784 WP_000099773.1.95308 WP_000099773.1.96934 WP_000099773.1.97149 WP_000099773.1.97781 WP_000099773.1.97861 WP_000099773.1.98216 WP_000099773.1.99445 WP_000099773.1.99454 WP_000099773.1.99485 WP_000099773.1.99994 YP_029880.1.16718 YP_037839.1.62562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]