SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281310.NTHI1696 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281310.NTHI1696
Domain Number 1 Region: 2-237
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.25e-63
Family Pseudouridine synthase RsuA/RluD 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281310.NTHI1696
Sequence length 239
Comment (Haemophilus influenzae 86 028NP)
Sequence
MLEILYQDEFLVAVNKPDGMLVHRSWLDPHETQFVMQTLRDQIGQHVFPIHRLDRPTSGV
LLFALSSEIANLMCEQFEQKCVQKSYLAVVRGYLQGKERIDYPLKIQLDKIADKFSQEDK
EPQEAVTDYEGLKIVEMPYPAGRYQTARYSLVKLIPHTGRKHQLRRHMKHIFHPILGDTQ
YGDLHQNRALMSHLGCSRLFLHSNSLSFIHPITKEQITITAGLDEQWHQLINQFGWENV
Download sequence
Identical sequences A0A0H3PMF2 Q4QKG1
281310.NTHI1696 WP_005656617.1.101989 WP_005656617.1.10621 WP_005656617.1.12329 WP_005656617.1.15261 WP_005656617.1.17459 WP_005656617.1.20853 WP_005656617.1.23149 WP_005656617.1.23920 WP_005656617.1.25656 WP_005656617.1.27712 WP_005656617.1.28397 WP_005656617.1.32618 WP_005656617.1.37003 WP_005656617.1.38938 WP_005656617.1.39279 WP_005656617.1.40343 WP_005656617.1.40942 WP_005656617.1.42240 WP_005656617.1.43923 WP_005656617.1.50588 WP_005656617.1.50795 WP_005656617.1.53947 WP_005656617.1.56005 WP_005656617.1.62697 WP_005656617.1.6349 WP_005656617.1.63539 WP_005656617.1.74240 WP_005656617.1.74810 WP_005656617.1.76410 WP_005656617.1.80605 WP_005656617.1.8829 WP_005656617.1.90320 WP_005656617.1.91188 WP_005656617.1.91769 WP_005656617.1.92858 WP_005656617.1.99776 gi|68250034|ref|YP_249146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]