SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA00093 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA00093
Domain Number 1 Region: 3-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-37
Family SPRY domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA00093
Sequence length 190
Comment (Caenorhabditis japonica)
Sequence
MVQNHRLPKKWDSNQASSYLELSQNGLTVSFKRNVSLQGDKDPSGVVRSDYPIPSSIGLY
YFEVEIRHGIRGCLGVGLSKEGGDLNRMPGWDPSCFGYHGDDGNFFSACGHGSSYGPKFV
TGDVIGCGIDTLLYHVFFTKNGKHLGIAYRGSEPFEKLYPTVGLKTPGEQLHANFGQKSF
MFDYDNYRDV
Download sequence
Identical sequences 281687.CJA00093 CJA00093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]