SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA00107 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA00107
Domain Number 1 Region: 537-559,589-748
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-24
Family Laminin G-like module 0.0041
Further Details:      
 
Domain Number 2 Region: 340-539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.28e-22
Family Laminin G-like module 0.0049
Further Details:      
 
Domain Number 3 Region: 111-240
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000459
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 4 Region: 26-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA00107
Sequence length 750
Comment (Caenorhabditis japonica)
Sequence
MRLLQFSLSIWLIVRAASSTSVFQGSCAAEHVLCEQLCESLSPDTYQCSCWEGHELQDDG
LSCKLKTDVQYSEERKSSTLRGARVFEPSTELPLKRMVVETVKGKKLDASKPLAFKGNNY
AEFPVKDDSYLETNITIQFKHDCGEGTIEDMYHGKFGIGEWHEINVWRKYCDLTEMKVDS
GRMLVDHADEFKNYKGITMDEGVFLGAAPHNIEYLQQKTGISEGFRGCVRLLIVNGEVLL
NSNETVNKAFDTSINYYCGQDENEKELEDSDDVIKIEMFDLTQRGIPKILETPGMNLPSP
TLKPIASSLPPLGHPILKEIVQELPSTTTTTTKKPLPANWKVAHFTGTSKVVLTAPESIL
NYLELSIQFKTEKSSGVIFFWKEDTKFLVVTLENSFVKVYASVGVDTTILRSRLFFSNVS
LLPFFAFRSENAVSLYHWHKLEVWRSGKGVLLKVNKQSWVESELHGIKDDILEETGDIYI
GAVNPEDTPTVVKQTEGFAGCVKRIRLNGRSIQMQSNLATNVSECFTDPCSSSGCPKQCI
SHNSQPICQCEWPLTGHKCSLTAESDLSSMAFAGFSHLELDDEAVMSHITGDSLNLAVNF
KIRNVAENVRQIIVSAGDVTHEDDFFELSLDTNRFIRFSLNLGSGIIVLTHPTRIEEERW
ITVEVIRKKNEVKLSVNGEDPITAFAPEGAEQLNVYKSVFVGNNYLPEGSSDGRDFTGFH
GCIISLRFDQTTISHPKQAKTAINIQDCQI
Download sequence
Identical sequences CJA00107 281687.CJA00107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]