SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA00451 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA00451
Domain Number 1 Region: 116-291
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-43
Family SPRY domain 0.000048
Further Details:      
 
Domain Number 2 Region: 46-137
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000353
Family F-box domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA00451
Sequence length 294
Comment (Caenorhabditis japonica)
Sequence
MSEKGSTTMDFGETSEACDSQGNPTIKSTSARRARSLQRPEVSAALLPLKVLNHIFQYLP
LKDLLSAMLTCHSWNNVLAMEDSDIWQAHLIRNVPDAALSDPFLLGKLGSARKKLRAWYY
AWNATDISRNNYIRTNGFTVHRQPVAQSTDGVRGKKGVLHGVHAFDITWDGPLGTVAVIG
FATKHAALHCIGYIALLGSDDQSWGWNLVDNVLMHNGQPLGVYPKMNNPPKYEMGERIRM
IIDCDKHVGYFERGTEFLGIAFSNIPPLRFYPAVCAVYGNTEVSMVYLGSPTMG
Download sequence
Identical sequences 281687.CJA00451 CJA00451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]