SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA00632 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA00632
Domain Number - Region: 1206-1337
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00226
Family Clostridium neurotoxins, the second last domain 0.092
Further Details:      
 
Domain Number - Region: 535-781,1577-1627
Classification Level Classification E-value
Superfamily ARM repeat 0.0595
Family HEAT repeat 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA00632
Sequence length 1791
Comment (Caenorhabditis japonica)
Sequence
MGDERTLSLLHLRKTFSEYLKIPVSGSRSNDPSRLLPLFHKVMSMYTPQQLSAEFKEVVH
FATFLCSVLVKEVRQRAASTGTIEAAQSIAEFLRPGSELKGWAILEAIRYLLSSEDEIMV
DAACKVSLPSTIVKTIYLFFDLPENTSENEEENAVRSNNERLYEMILQIMEGLCRFKWKK
NRKIQQKIQLKFGECSDRSKTLGNRFQNISGHSLKISDQNIDFENFENLYFDLKFSGNVL
EYFLNDFPKCQTDRSILRIFAEFFAGIFYFSLFLCVSEELVRKDDLLLLFVGTTSQVANV
NNCWRKMCARLLEVIADKSLTNAVIKYVVVKKCVRIFVKNISSAPTSTHADAQKTAEAII
CLSCFLKNSAYLTDSLLDEFYEADGYTVIKDFLLRKLKRKILRSSGENFRGGTKKKIFFR
FFLFFRVFFWMGQKIFYKKFFDFFFDGESGTKKFLFFFSMVRVRPKNFVFFFDDEKKFFF
CFFVNFFESKKKFFFFWYFFFFCFFFFGNFFEDKKSFFFFCGKFFFSLSEATSCTVIDIL
HSIYTCDPANYFILDREYPLSIFIDQLERKPHAVRVKLLELVEFAVFQLNHIPCRELISL
CVLLKTEISAGKTAMCTIIVQMCFKLITVDAIIKDAFREVGLLDALCYIIRRMYELFHRQ
HSTTSSQIAPSFTATSTSSRSQDQLKLSLLTTDLLTIIIKKNVENGKLFTECFGAKLLVE
IICEVSEDWRSSLLQLVKQLLIVAPTDQYIVHVVNTLNDRIPIENLEVMFSLLKALLGVV
RESHKVRIQFRKSGGFLALSALLLGLEKRFADVQPESDGRIPREYCQMLEFVHIIFKVFT
LSMRFDILSTERCKRAPFAQWWTRPCWRRESSENQESRGRFFALISLNLTPNACEIFCSF
GITWDSITSLLRLTSIFTESTVISIEEPEWSSLSTSDFSNEISACHEVFRLDDNIEAGNV
PANMPFGVYFGCYVIRLIFNMALDNYEKMQTDIKWSDGASLEESIVSWTSSLLVHPGAII
SMLCLLPSITSGKSENNMKWTVAAQYYVSLLLKSILKSERNQQIMCQVDMPKHLLRIAEK
LFLAENHLLLQPFYYLLERLSYQSLTPNQLRSFLRLDSPLCCRSLDDNEEIAENHCANSL
SSEGGPVPLQRVKALVSMMTPRDQYVGTAPSFVEFDMSVEGFAALYLPSLAPMFSTTKTE
RIFPPLNGFSFCTWIYLDTLSDKKADAHPIRLLTVTRAVAPADATKKPAHLACFQVQFSA
FDRSLLISTEESDQPGADLEKIANFQTDKLIRITLADQVRCGEWFHLAIIFNRSVLKSSQ
VSVYLNGRHLSTQKLMYVAQNAGGAATQLAQTYSVNAAVGTLPALRRPSRLRFRLASIFL
AEEPMTAETVRAVVLLQPHYIGNFQTASAEKTPLVHEEKLGISPNDHSTPLRVLCNTISH
APGAGRTFGGVVVGYLGMRTFTPRPVPSLLDSIGGFASVYGLIAMAIDSEGLYASLKSLV
SAVRSNPKLLATWNNNRSYQILAVLLEDKAKMLNSHIMHMVFNVTGTADTSREHAPTIAN
PSAFEDLLCDLKVWRGAPSELHKMLLEHFYELITDHQLTNLQVIRRSSLLSRLLLLIHDE
PIFVRNTDEIVFNLISAIVQPQCDGRSILKIGQCIAATLPTSESECYEESRLPFHISEIQ
KLFVDATNPDETAPLPPAAHAVYIRNRLLNIIANFLSNSSPQIQSQMCDQLVRTLGFDWL
FALMSAGVHGGTIYLALRILLLVLNQPTLLAKFKEGSSNGGWLSEADSVVR
Download sequence
Identical sequences 281687.CJA00632 CJA00632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]