SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA00898 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA00898
Domain Number 1 Region: 81-232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000149
Family MAM domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA00898
Sequence length 449
Comment (Caenorhabditis japonica)
Sequence
MQIHVEQACLSNQETCSVATYRYNSDCRAQLDRGLRSSSYHGSYSGFLGENVRARAYSEH
GSSNDFAKSDSELHCLSVLNCTWQNTIEDDLDWVLGEGQVDPTKLALITGSQSLPGSFDQ
SFLILASDPRPSHQNGQLVSLPIGCQQATGILSFRYWRSRARTIGSEPKLDICTRKVLEV
DLENCMTVVPTDNHTIIASIPPVMEPFVIVLKGYNFENEPEGGLILIDEIEYFAMLDRPE
DCVAKNLMGEVDIEEFPKKENKLERTEEKVSGDTPEYKPEAHYVSRDVSQQAAPTIVNSS
SSVTELIQLNENSNNDCQSLQCLMDQKNAPCDYKRSGSGSQGEGYLVGWRITSVNKNVAN
KLTGIHHSPGSSLGLKLSVFIRSCFWNVYENSAEPFAKKWTKEVVLLPGQLTTFYIIAWQ
NTSTVVNFGQIGLSEIGLFSDSQAISPLC
Download sequence
Identical sequences CJA00898 281687.CJA00898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]