SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA01226 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA01226
Domain Number - Region: 306-357
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0593
Family Calponin-homology domain, CH-domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA01226
Sequence length 454
Comment (Caenorhabditis japonica)
Sequence
MEHDTNETVASYELKITEPFEKFAEYNDVLEMRMELDNVLGFDRRYDAKINILPLGKQPA
ASSFLSIMGKLKGEKCSSMTGLAERWAPRVMVHVFKTTSEIELSWQTAPAFLCIKTYEII
LQNRDGVILNTTEIEVIPGQLEANTTFSNIERNQMIQVKVRGKNAIDGRCACVNCNCITD
KTKFFIIPEVTKTIQTPDPLLSTTALSISEDDFGFSRVSILLIVLACLMISAWGCLYCRK
NNKIMWKKKIAFNALKTSSGADQKRGPRKFHKILLVCPEIEGKDYDYMMRIANALKNSNN
SVVYDRWRENGKHAEENMLRWVNDQTQKAEKIIIFHSTSYQPSCGVYDLINSFFPGTDSR
LIHVALTADAKRVAPRDVEYVLPRDQQLLKEAYGIEISEPLAIDIPREVMNTKPFFPNVA
CDSIEDDSPSNTENHSTDSGVVIDVQQLFRVGWD
Download sequence
Identical sequences CJA01226 281687.CJA01226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]