SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA01274 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA01274
Domain Number 1 Region: 88-165
Classification Level Classification E-value
Superfamily RNI-like 0.000000000706
Family 28-residue LRR 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA01274
Sequence length 191
Comment (Caenorhabditis japonica)
Sequence
MVLALGQHNIPGLRWIIEGFNYYDTQRVKEVGADRAAAEWIVKCGGQIKFAQIDESFDDF
NALVKRTAQLDPRRREDNVTLETIRCVDASVTGFGCRHFENLRGIRHVHFIGCKNFHDFG
LEYMGQHVGDCLKTLHLESCPRITEFGLEHLNKFSALETLILRQLKSVHGKEKVEQKLRK
ALPKTDIQINL
Download sequence
Identical sequences 281687.CJA01274 CJA01274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]