SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA01872 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA01872
Domain Number 1 Region: 313-390
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.15e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00018
Further Details:      
 
Domain Number 2 Region: 46-115
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.00087
Further Details:      
 
Domain Number 3 Region: 112-202
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000729
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA01872
Sequence length 397
Comment (Caenorhabditis japonica)
Sequence
MMIKMDSLATNSPKAMKREHDNDDGDRNGRHKRPKTDGFTEAIQQGKFEVRLLVSSKSAG
AIIGKGGENIKRLRAEFNAHVQVPDSNTPERICTMTADEKTVLNIMKDVLPRLEDNFSER
DPCELRMLIHQSHAGALIGRNGTKIKELREKCSARLKIFTGCAPGSTDRVLITSGEQKNI
LAIVEEVMRELKEIPIKGAATPYLPSFNYDPSAISEYGGFPGNMQSGGPPHRSQGPPRGP
PGPPRGGGYGGPAPPHNAGSGGPRSFDAGDFQQFRGGPGPVPGYAMAAPGYPPPQQQYGA
PSNAGYGYGPGGGGPVTTAQVTIPSDLGGTIIGRGGERIARIRQESGAQITLEQSNGQSE
RIITIKGTEQQIHSAQYLLQQCVRNSTQGRERFGGSL
Download sequence
Identical sequences K7GUV7
CJA01872 281687.CJA01872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]