SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA02159 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA02159
Domain Number 1 Region: 103-172
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000351
Family Eukaryotic type KH-domain (KH-domain type I) 0.0067
Further Details:      
 
Weak hits

Sequence:  281687.CJA02159
Domain Number - Region: 179-330
Classification Level Classification E-value
Superfamily LigT-like 0.000235
Family Atu0111-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA02159
Sequence length 391
Comment (Caenorhabditis japonica)
Sequence
MTSSFPLFTGTYSINARRYRKTPYQLKKLAENDKAASYQQEKFVDTPDYYEDEPDFGCMA
PPGLPALKSKSKKQKVEKEESVTSTDPQPTEDERVQVIGGKKWIATISVPNCFIGKLIGM
NRRALNALENETQCRMKTPRRDENKPCEITSLVSLESVQRCLDRVEIFLDDARKSARPTH
FVAFPCDEPEIQDNFAVFKQVVMESEHFDNSCKNPLLFTKPARLHMTLSVARIFDDADIQ
KTQEAFKTLEQEIKEILGSEPLIADIQGIDMMNDDPSQVSVIYAKVGGAKIQTVANHIAH
RLPELGVAAENRGEAVKLHVTLMNARYVAQADGKSKNFTFDATKVLEDLREMYFGTVQIK
LCLCPLNSSTSAEKFYEKLVSFTLKGIMSKA
Download sequence
Identical sequences 281687.CJA02159 CJA02159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]