SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA02378 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA02378
Domain Number 1 Region: 111-603
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.02e-162
Family Calponin-homology domain, CH-domain 0.00000000216
Further Details:      
 
Domain Number 2 Region: 2-79
Classification Level Classification E-value
Superfamily EF-hand 0.00000035
Family Calmodulin-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA02378
Sequence length 625
Comment (Caenorhabditis japonica)
Sequence
MLTREQLTDLNENFKTVSESGSGFLARSDVQTALKILGIDVPGYKMRELLDQHFGNQGQI
DVDRFAKLYETLDEQRNEEANRWKQQTKQVSGAYQVHSSKQENAHHTIRVEEEVAFSNWI
NSNLSDDVDLKRLLPVNPQGGELYTKVQDGLVICKLINLAVPGTIDERAINKKNLNTYTK
LENLTLALMSSQAIGCNIINIDNIDLSKGTAHLVLGLLWQIIRIGLFNQIDLQHCPGLFR
LLRDGETLDDLRRLSPEEILMRWVNYHLERAGTQRRLHNFTSDIVDSEIYTHLLNQIAPI
GSGVTLSPLGVQGNVPRAGAMLDEAEKLDCREFVTATDVAAGNYKLNLAFVANLFNKHPN
LPDPGADEVVEDVVEETREEKTYRNWMNSMGVDPYVNWLYGDLQNGVVIFQLYDIIRPGM
VIWKRVVRTFHKLRGMMDQIQNCNYAVELGKQLRFSLVGIQGKDIYDGNQTLTLALVWQL
MRAYTLSVLAQCTQSGDSLPADKDIVAWVNEKLASSGKSSSIRSFQDSAISDGRVVLDLI
DAIKPNVIDHSLIKSGGSNEDKMSNAKYAITCGRKIGAKIYALPEDITEVKPKMVLTVFA
CLMARGYMPDMKEASAPVAPMMNGH
Download sequence
Identical sequences CJA02378 281687.CJA02378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]