SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA02620 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA02620
Domain Number 1 Region: 105-261
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.32e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000897
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA02620
Sequence length 491
Comment (Caenorhabditis japonica)
Sequence
MPKNPKSFAEDSIVLKEIVDDEQESPLLKSESVVELKSLLKLIDNVIESAPATDDDDSPV
KADQSNPFLCEVPIQNNENRRPKRNQSDHSQKQSSGDGGDGKVMLTETLMVPVKKYPKYN
FVGRILGPRGMTVKQLERETGCKIFVRGRASSTTFNPHTKATRSPFNLKATLSTISQSAL
TDDPLHVYIECLDYPESGKKKMAHAVAIVNELLSPPVGQENVVQNCNDRISFQVDGKDEL
KRQQLVDISLINGTYRPTSISNDITRPLRRSQWGQSVDPTSNPADLELKPLRKELGGTGR
AQGDFGVVYGIAQQKRIWQKPRGPDTSSEEYAKSVSSREFVSDIVNKNKNSPVKSSKGSS
DDSLYQLPQSVVSETLKVAMNLLASHKHMAYSHQPEERREFDDGKSEIPRISSLGSGDAP
GEDAVAHDYPHQMAPPPPLMHHSNPYAAPPFSTDLYFPAQMPSPYSDFPPGPPLYYMFPP
PPPAHFNPRHY
Download sequence
Identical sequences CJA02620 281687.CJA02620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]